125742 S1 M4 4.2.1 r 20 0085

Pfizer Documents (PHMPT/FDA)

Pfizer Bla Submission

Pfizer 16 Plus Documents

94

Document text

BioNTec h SE 
An der Goldgrube 12  
55131 Mainz, Germany  
Phone: +49 (0)6131 9084 -0 
Telefax: +49 (0)6131 9084 -390 
R&D STUDY REPORT N o. R-20-0085 
COVID -19: IMMUNOGENI CITY STUDY OF THE LNP-
FORMULATED MODRNA EN CODING THE VIRAL 
S PROTEIN -V9 
Version 04 
Date: 23 NOV 2020  
Reported by  
Test i tem: BNT162b2 ( animal trial material ) 
Key words: Coronavirus, COVID -19, modRNA, ATM, mouse, immunogenicity  
This R&D report  consists of 93 pages.  
 
Confidentiality Statement: The information contained in this document is the property and copyright of  
BioNTech RNA Pharmaceuticals GmbH . Therefore, this document is provided in confidence to the recipient (e.g. , 
regulatory authorities, IECs/IRBs, investigators, auditors, inspectors). No information contained herein shall be 
published, disclosed , or reproduced without prior written approval of the proprietors.  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
(b) (6)
FDA-CBER-2021-5683-0708936
  
 
R&D Report R -20-0085 Version 0 4 Page 2 of 93 
  Strictly Confidential  
TABLE OF CONTENTS  
TABLE OF CONTENTS  ................................ ................................ ........................  2 
LIST OF FIGURES  ................................ ................................ ................................  3 
LIST OF TABLES  ................................ ................................ ................................ .. 4 
LIST OF ABBREVIATION S ................................ ................................ ...................  5 
RESPONSIBILITIES  ................................ ................................ ..............................  6 
1 SUMMARY  ................................ ................................ ...........................  7 
2 GENERAL INFORMATION  ................................ ................................ .. 8 
2.1 Participating Personnel  ................................ ................................ .........  8 
2.2 Study Dates  ................................ ................................ ..........................  9 
2.3 Guidelines and Regulations  ................................ ................................  10 
2.4 Changes and Deviations  ................................ ................................ ..... 10 
2.5 Documentation and Archive  ................................ ................................  11 
3 INTRODUCTION  ................................ ................................ ................  12 
3.1 Background  ................................ ................................ ........................  12 
3.2 Objectives  ................................ ................................ ...........................  13 
3.3 Study Design  ................................ ................................ ......................  13 
4 MATERIALS AND METHOD S ................................ ............................  15 
4.1 Test Item  ................................ ................................ .............................  15 
4.2 Control Item  ................................ ................................ ........................  15 
4.3 Test System  ................................ ................................ ........................  15 
4.4 Materials  ................................ ................................ .............................  15 
4.5 Methods  ................................ ................................ ..............................  21 
4.5.1  ANIMAL CARE  ................................ ................................ ...................  21 
4.5.1.1  GENERAL INFORMATION  ................................ ................................  21 
4.5.1.2  HOUSING CONDITIONS A ND HUSBANDRY ................................ .... 21 
4.5.2  ANIMAL MON ITORING  ................................ ................................ ...... 21 
4.5.3  ANIMAL TREATMENT  ................................ ................................ ....... 22 
4.5.3.1  TREATMENT SCHEDULE, ROUTE OF ADMINISTRAT ION, AND 
DOSE  ................................ ................................ ................................ . 22 
4.5.3.2  IMMUNIZATION  ................................ ................................ .................  22 
4.5.3.3  BLOOD SAMPLING VIA T HE RETRO -ORBITAL VEN OUS PLEXUS 
OR VENA FACIALIS  ................................ ................................ ...........  22 
4.5.4  ENDPOINT OF EXPERIME NT/TERMINATION CRITE RIA ................  23 
4.5.4.1  DISSECTION OF ANIMAL S AND ORGAN COLLECTI ON .................  23 
4.5.5  ELISA  ................................ ................................ ................................ . 23 
4.5.6  SURFACE PLASMON RESO NANCE SPECTROSCOPY  ..................  24 
4.5.7  PSEUDOVIRUS -BASED NE UTRALIZATION TEST  ..........................  24 
4.5.7.1  PRODUCTION OF SARS -COV-2-S PSEUDOTYPED V SV 
VECTOR  ................................ ................................ .............................  24 
4.5.7.2  TITRATION OF VSV/SAR S-COV -2-S PSEUDOVIRU S .....................  25 
4.5.7.3  PSEUDOVIRUS -BASED NE UTRALIZATION TEST  ..........................  25 
4.5.8  PREPARATION OF SPLEN OCYTES  ................................ .................  26 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708937
  
 
R&D Report R -20-0085 Version 0 4 Page 3 of 93 
  Strictly Confidential  
4.5.9  ELISPOT ASSAY  ................................ ................................ ................  27 
4.5.9.1  SUBTYPING OF CD8+ VERSUS CD4+ T-CELL RESPONSES  ..........  27 
4.5.10  LUMINEX ASSAY  ................................ ................................ ...............  28 
4.5.11  INTRACELLULAR CYTOKI NE STAINING  ................................ .........  28 
4.5.12  STATISTICAL ANALYSIS  ................................ ................................ .. 29 
5 RESULTS  ................................ ................................ ...........................  30 
5.1 ELISA  ................................ ................................ ................................ . 30 
5.1.1  WHOLE IGG ELISA  ................................ ................................ ............  30 
5.1.2  IGG SUBTYPE -SPECIFIC  ELISA  ................................ .......................  35 
5.1.3  IGG2A/IGG1 RATIO  ................................ ................................ ...........  37 
5.2 Binding Kinetics of Antigen -specific IgGs Using SPR  .........................  37 
5.3 Pseudovirus -based Neutralization Test  ................................ ..............  39 
5.4 ELISpot Analysis  ................................ ................................ .................  40 
5.5 Luminex Assay  ................................ ................................ ...................  43 
5.6 Intracellular Cytokine Staining  ................................ ............................  46 
5.7 Animal Monitoring  ................................ ................................ ...............  49 
6 CONCLUSION  ................................ ................................ ....................  51 
7 DOCUMENT HISTORY  ................................ ................................ ...... 52 
8 REFERENCES  ................................ ................................ ...................  53 
9 APPENDIX  ................................ ................................ .........................  54 
APPENDIX  1: ANIMAL M ONITORING - OBSERVAT IONS ................................ . 54 
APPENDIX  2: CERTIFICATES OF ANAL YSIS  ................................ ...................  58 
APPENDIX  3: CONTROLS  FOR ELISPOT ANALYSI S ................................ ...... 62 
APPENDIX  4: SUMMARY OF LUMINEX ASSAY DAT A ................................ ..... 63 
APPENDIX  5: DETAILED  ICS PROTOCOL  ................................ ........................  65 
APPENDIX  6: STATISTI CAL ANALYSIS  ................................ ............................  71 
 
LIST OF FIGURES  
Figure  1: Schematic overview of the S protein organization of the SARS -CoV-2 
S protein.  ................................ ................................ ................................ .............  12 
Figure  2: ELISA screening analysis on days 7, 14, and 21 against the recombinant 
S1 protein  ................................ ................................ ................................ ............  30 
Figure  3: ELISA screening analysis on days 7, 14, and 21 against the recombinant 
RBD  ................................ ................................ ................................ .....................  31 
Figure  4: ELISA endpoint titration on day 28  ................................ .......................  32 
Figure  5: Kinetics of the antibody concentration against the viral  antigen  ...........  33 
Figure  6: ELISA endpoint titration (long titration)  ................................ .................  34 
Figure  7: Reciprocal serum endpoint titer at day 14 and 28 after immunization  .. 35 
Figure  8: IgG subtype -specific ELISA on day 28  ................................ .................  36 
Figure  9: ELISA endpoint titration on day 28 (IgG subtypes)  ...............................  36 
Figure  10: IgG2a/IgG1 subtype ratio on day 28  ................................ ...................  37 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708938
  
 
R&D Report R -20-0085 Version 0 4 Page 4 of 93 
  Strictly Confidential  
Figure  11: Binding affinities of vaccine -elicited IgG for S1 -His and RBD -His protein
 ................................ ................................ ................................ ............................  38 
Figure  12: Titers of neutralizing antibodies on days 14, 21, and 28  .....................  40 
Figure  13: ELISpot analysis using fresh splenocytes on day 28  ..........................  41 
Figure  14: ELISpot analysis using frozen splenocytes on day 28  ........................  42 
Figure  15: ELISpot analysis using splenocytes of 5  µg BNT162b2 (RBP020.2) 
immunized mice on day 28 after MACS cell separation  ................................ ...... 43 
Figure  16: Cytokine concentrations in supernatants of re -stimulated splenocytes 
28 days after immunization  ................................ ................................ ..................  45 
Figure  17: CD4+ T cell intracellular cytokine staining 28 days after 
immunization  ................................ ................................ ................................ ....... 47 
Figure  18: CD8+ T cell intracellular cytokine staining 28 days after 
immunization  ................................ ................................ ................................ ....... 48 
Figure  19: Body weights of experimental mice during study  ................................  49 
Figure  20: Summary of observations made during study’s concomitant animal 
monito ring ................................ ................................ ................................ ............  50 
Figure  21: Controls for ELISpot analysis using splenocytes on day  28 ...............  62 
Figure  22: T H1 and proinflammatory cytokine concentrations in supernatants of re -
stimulated splenocytes 28  days after immunization  ................................ .............  63 
Figure  23: T H2 cytokine and IL -2 concentrations in supernatants of re -stimulated 
splenocytes 28  days after immunization  ................................ ..............................  64 
 
LIST OF TABLES  
Table  1: Study design  ................................ ................................ ..........................  14 
Table  2: Materials  ................................ ................................ ................................  15 
Table  3: Equipment  ................................ ................................ .............................  19 
Table  4: Software  ................................ ................................ ................................  20 
Table  5: Peptide pools for stimulation of splenocytes for ELISpot assays  ...........  20 
Table  6: Summary of binding kinetic parameters of vaccin e-elicited IgG for S1 -
His ................................ ................................ ................................ .......................  38 
Table  7: Summary of binding kinetic parameters of vaccine -elicited IgG for RBD -
His ................................ ................................ ................................ .......................  39 
Table  8: Chemokines and cytokines included for multiplex measurement  ..........  43 
Table  9: Parameters for experimental animal monitoring (single mouse 
assessment)  ................................ ................................ ................................ ........  54 
Table  10: Record of body weights of experimental mice during study  .................  56 
Table  11: Record of animal monitoring for each mouse during study  ..................  57 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708939
  
 
R&D Report R -20-0085 Version 0 4 Page 5 of 93 
  Strictly Confidential  
LIST OF ABBREVIATIONS  
AH-1 Irrelevant peptide derived from endogenous retroviral gene product envelope 
glycoprotein 70  
ATM  Animal trial material  
BCS Body Conditioning Score  
BNT162  BioNTech’s SARS -CoV-2 vaccine candidate  
CD Cluster of differentiation  
ConA  Concanavalin A  
COVID -19 Coronavirus disease emerged 2019  
DMSO  Dimethyl sulfoxide  
DPBS  Dulbecco ’s phosphate -buffered saline  
EDTA  Ethylenediaminetetraacetic acid  
ELISA  Enzyme -linked immunosorbent assay  
ELISpot  Enzyme -linked immune absorbent spot  
FBS Fetal bovine serum  
GFP Green fluorescent protein  
GM-CSF Granulocyte -macrophage colony -stimulating factor  
GMP  Good manufacturing practice  
Hsopt10  Nucleoside optimization protocol 10 based on Homo sapiens  databank  
ICS Intracellular cytokine staining  
IFN Interferon  
Ig Immunoglobulin  
IL Interleukin  
i.m. 
KD 
koff 
kon Intramuscularly  
Binding affinity  
Dissociation rate constant (off-rate) 
Association rate constant (on -rate) 
LNP Lipid nanoparticle  
LLOQ  Lower limit of quantification  
MACS  Magnetic cell separation  
modRNA  Nucleoside -modified mRNA  
nAb Neutralizing antibody  
No. Number  
OD Optical density  
PBS Phosphate -buffered saline  
PMA  Phorbol 12 -myristate 13 -acetate  
pVNT  Pseudovirus -based neutralization test  
RBD  Receptor -binding domain  
RNA  Ribonucleic acid  
S protein  Spike protein  
S1 Subdomain 1 of the S  protein  
S2 Subdomain 2 of the S  protein  
saRNA  Self-amplifying mRNA  
SARS -CoV-2 Severe acute respiratory syndrome  coronavirus -2 
SPR Surface plasmon resonance  
TH1/T H2 Type 1/2 helper T  cells 
TNF Tumor necrosis factor  
ULOQ  Upper limit of quantification  
uRNA  Uridine -containing mRNA  
V Variant  
VSV Vesicular stomatitis virus  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708940
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)     
 
  
   
 
 
   
  
     
   
        
   
  
 
 
 
 
 
               
              
              
    
        
              
      
            
  
  
(b) (6)
 
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
FDA-CBER-2021-5683-0708941
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT) 
        
  
           
           
             
             
           
              
           
                   
             
             
          
            
            
           
    
           
             
           
           
               
            
            
              
     
   
     
              
            
            
             
              
             
          
           
   
      
 
  
(b) (6)
FDA-CBER-2021-5683-0708942
  
 
R&D Report R -20-0085 Version 0 4 Page 8 of 93 
  Strictly Confidential  
2 GENERAL INFORMATION  
Sponsor  
BioNTech RNA Pharmaceuticals GmbH  
An der Goldgrube 12  
55131 Mainz  
Germany  
Test Facility  
BioNTech SE  
An der Goldgrube 12  
55131 Mainz  
Germany  
2.1 Participating Personnel  
Responsible p erson:  
(as defined in SOP -100-024) 
An der Goldgrube 12  
55131 Mainz  
Author:  
BioNTech SE  
Experimenter:  
BioNTech RNA Pharmaceuticals GmbH  
Experimenter:  
BioNTech RNA Pharmaceuticals GmbH  
Experimenter:  
BioNTech RNA Pharmaceuticals GmbH  
Experimenter:  
BioNTech RNA Pharmaceuticals GmbH  
Experimenter:  
BioNTech SE   
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
FDA-CBER-2021-5683-0708943
  
 
R&D Report R -20-0085 Version 0 4 Page 9 of 93 
  Strictly Confidential  
Experimenter:  
BioNTech SE  
Experimenter:  
BioNTech RNA Pharmaceuticals GmbH  
Experimenter:  
BioNTech RNA Pharmaceuticals GmbH  
Experimenter:  
BioNTech SE 
Experimenter:  
BioNTech RNA Pharmaceuticals GmbH  
Experimenter:  
BioNTech RNA Pharmaceuticals GmbH  
Experimenter:  
BioNTech RNA Pharmaceuticals GmbH  
Experimenter:  
BioNTech Diagnostics GmbH  
Experimenter:  
BioNTech Diagnostics GmbH  
Experimenter:  
BioNTec h RNA Pharmaceuticals GmbH  
 
2.2 Study Dates  
Start of experiments:   31 MAR  2020  
Completion of experiments:  17 SEP 2020  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
FDA-CBER-2021-5683-0708944
  
 
R&D Report R -20-0085 Version 0 4 Page 10 of 93 
  Strictly Confidential  
2.3 Guidelines and Regulations  
All experiments are executed in accordance with the existing standard operating 
procedures and described processes from BioNTech  SE. Applicable documents are 
listed below.  
 Animal test application approval number: G18 -12-100, amendment from 
18.02.2020 (approved 20 FEB 2020)  
 SOP-010-017 Brutschränke - Biolytics  
 SOP -010-028 Vi-Cell XR  
 SOP -010-045 Brutschrank HERAcell 150 i 
 SOP -010-047 Zentrifuge Eppendorf 5810/5810R  
 SOP -010-051 Tiefkühlschränke -80 °C  
 SOP -010-058 Sicherheitswerkbank Klasse II  
 SOP -010-086 Zentrifuge Thermo Scientific Heraeus Pico und Fresco 17  
 SOP -010-099 CTL ELISPOT Reader  
 SOP -020-009 Ansetzen von Medien und Zusätzen für die Zellkultur  
 SOP -030-043 Kryokonservierung von Zellen  
 SOP -030-071 Abtöten von Mäusen  
 SOP -030-072 Fixiergriff und Ohrmar kierung bei Mäusen  
 SOP -030-073 Betäubung bei Mäusen  
 SOP -030-074 Blutentnahme bei Mäusen  
 SOP -030-078 Isolierung muriner Splenozyten  
 SOP -030-079 Intramuskuläre A pplikation bei Mäusen  
 SOP -030-110 IFN γ ELISpot (murin ) 
 SOP -030-112 Durchführung eines virusprotein -spezifischen ELISA  
 SOP -090-013 Biological safety in laboratories  
 SOP -110-022 Entsorgung von Biostoffabfällen  
2.4 Changes and Deviations  
This R&D study was conducted according to R&D plan P -20-0085. 
A change occu rred in the pVNT. It was planne d to perform this analysis with an external 
partner, . However, the CRO had no pVNT or VNT in place when samples 
were ready to analyze. Therefore, an internal assay was developed using the VSV -
based pseudovirus to analyze for neutralizing anti bodies.  
Furthermore vaccine -induced SARS -CoV-2 specific antibodies were analyzed for their 
affinity toward  recombinant SARS -CoV-2 S and RBD protein via surface plasmon 
resonance (SPR) spectroscopy . Affinity measurements were only conducted with day 
28 sera  of the 5  µg BNT162b2 dose cohort.  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
(b) (4)
FDA-CBER-2021-5683-0708945
  
 
R&D Report R -20-0085 Version 0 4 Page 11 of 93 
  Strictly Confidential  
Another change occurred in the protocol for murine ELISpot, described within SOP -
030-110. The described change resulted in faster dryness of the ELISpot plate and 
thus its readiness for the subsequent protocol step; analy sis of spot numbers per well 
via ImmunoSpot® S6 Core Analyzer, CTL. This change has no impact on performance 
of the protocol.  
Furthermore, in a first  run with fresh splenocytes a mis calculation of cells in the group 
immunized with 5 µg modRNA  occurred. Therefore , a second ELISpot run was  
included with frozen splenocytes . 
Because the utilized major histocompatibility complex (MHC ) I/II blockade was not 
effective in determining T -cell subtypes, an additional ELISpot analysis was performed 
after separation of CD4+ and CD8+ cells by MACS isolation to identify the responding 
T-cell subtype (group 4 only).  
Cytokine concentrations in sup ernatants of re -stimulated splenocytes were determined 
using a bead -based, T H1/T H2 mouse ProcartaPlex immunoassay.  An intracellular 
cytokine staining was added for TH1/T H2 cytokine analysis.  
2.5 Documentation and Archive  
Study plans and reports are stored and archived according to SOP -100-003 Archiving 
of Paper -Based Documents.  
Raw data and evaluated data are saved at : 
 P:\BioNTechRNA \RN9391R00_ CoV-VAC\04_Preclinic \00_Pharmacology \ 
mCorVAC# 11_modRNA -V9 
 Animal Models & Facility: Lab book No. 1893  
 Infectious Disea se Vaccines (ELISA): Lab book No. 1858 , 1978  
 Infectious Disease Vaccines  (ICS) : Lab  book No. 1937  
 Immunomodulators: Lab book No. 1935, 1936  
 Cancer Vaccines: Lab book No. 1934  
 New Scaffolds: Lab book No. 2009  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708946
  
 
R&D Report R -20-0085 Version 0 4 Page 12 of 93 
  Strictly Confidential  
3 INTRODUCTION  
3.1 Background  
In December 2019, an outbreak of pneumonia of unknown cause in Wuhan, Hubei 
province in China was reported . The disease spread rapidly and in January 2020, the 
agent was identified. By 21 June  2020, infection with the novel coronavirus ( SARS -
CoV-2) was con firmed in over 8,700,000 people with more than 460,000 casualties1. 
A vaccine is urgently needed and B ioNTech  decided to develop a rapid vaccine project 
based on the surface or spike protein (S  protein) of the virus as the viral antigen. The 
S protein is a  trimer and during viral egress, the precursor protein is cleaved in S1 and 
S2 (Figure  1). While the S1 domain recognizes the host receptor, the S2 domain is 
essential for the membrane fusion of viral envelope and endosomal membrane. To 
initiate the membrane fusion, the S2 domain undergoes a conformational change 
within the central helix domain.  
 
Figure  1: Schematic overview of the S protein organization of the SARS -CoV-2 S protein.  
The sequence within the S1 subunit consists of the signal sequence (SS) and the receptor -binding domain (RBD) 
which is the key subunit within the S  protein which is relevant for binding to the huma n cellular receptor ACE2. The 
S2 subunit contains the S2 protease cleavage site (S2’) followed by a fusion peptide (FP) for membrane fusion, 
heptad repeats (HR1 and HR2) with a central helix (CH) domain, the transmembrane domain (TM) and a 
cytoplasmic tail  (CT); source: modified from ( Wrapp et  al. 2020 ). 
 
Based on these features, the S  protein is the target of the neutralizing antibody (nAb) 
that binds dominantly to the RBD of the S  protein. V accine candidates selected for 
non-clinical  testing include the following vaccine antigens:  
 A secreted  variant of the RBD of the SARS -CoV-2 S protein (called V5) 
(Kirchdoerfer et  al. 2018 ) 
 Membrane -tethered full -length S protein with two point mutations within the 
central helix domain (called V8/V9). Mutation of the two amino acids to proline, 
(KV286 -287PP) retains the S protein in an antigenically optimal prefusion 
conformation  (called V8 or V9) ( Wrapp et  al. 2020 , Pallesen et  al. 2017 ) 
                                            
1 Coronavirus diseas e (COVID -2019) situation report 153, World Health Organization; 
www.who.int/emergencies/diseases/novel -coronavirus -2019/situation -reports  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708947
  
 
R&D Report R -20-0085 Version 0 4 Page 13 of 93 
  Strictly Confidential  
The development of in vitro transcribed RNA as an active platform for the use in 
infectious disease vaccines is based on the extensive knowledge of the com pany in 
RNA technology, which has been gained over the last decade.  The core innovation is 
based on in vivo delivery of a pharmacologically optimized, antigen -coding RNA 
vaccine to induce robust neutralizing antibodies and accompanying/concomitant T  cell 
response to achieve protective immunization with minimal vaccine doses 
(Vogel  et al. 2017 , Moyo et  al. 2018 , Pardi et  al. 2017 ). 
At BioNTech, there are three different RNA  platforms under development, namely  non-
modified uridine -containing mRNA (uRNA), nucleoside -modified mRNA (modRNA) , 
and self -amplifying RNA (saRNA). It is unknown today which RNA vaccine platform 
performs best in terms of activation and duration of a pote nt immune response. 
Therefore, BioNTech has developed a project plan that is based on testing GMP -
produced, available material that has already been tested in clinical trials. The three 
vaccine platforms will be tested for each antigen construct in non -clinical mouse 
studies and tested for their virus -neutralizing response and the total amount of IgG 
antibodies developed against the S  protein. Candidates that induce a high fraction of 
nAb within the total IgG population are desired. This repor t covers a mou se study 
testing mod RNA encoding the antigen variant 9 (V9) of the generated variants of the 
S protein.  
3.2 Objectives  
In this study, the primary objective was to understand the immunogenicity of the 
designed construct. For this purpose, a dose titration in BA LB/c mice was performed 
with the LNP -formulated modRNA encoding the antigen variant 9 (V9) of the generated 
variants of the S  protein ( V9 main characteristics: S protein full -length with two point 
mutations, opt1 sequence optimization that increases the GC -content of the coding 
sequence ). The immune response was analyzed focusing on the antibody immune 
response and included the analysis of the IFN - release of splenocytes at the end of 
study  as well as assessment of cytokine/chemokine responses . 
3.3 Study Design  
Four groups of eight female BALB/c mice were immunized once (on day  0) with 
BNT162 b2 at three different doses, or with the buffer alone (control group). 
Immunizations were given intramuscularly (i.m.) in a dose volume of 20  µL. Blood was 
collected o nce weekly for three weeks (days 7, 14, and 21) to analyze the antibody 
immune response by ELISA and pseudovirus -based neutralization assay (pVNT). At 
the end of the study (on day  28), blood was collected for ELISA and pVNT analyses 
(all samples), as well as for affinity measurements of vaccine -induced antibodies 
toward  recombinant SARS -CoV-2 S and RBD  via SPR (high -dose  cohort samples  
only).  Animals were then euthanized for spleen collection and additional analysis of 
the T -cell response in splenocytes by ELISpot, Luminex assay , and ICS (see Table  1). 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708948
  
 
R&D Report R -20-0085 Version 0 4 Page 14 of 93 
  Strictly Confidential  
Table  1: Study design  
Group 
no. No. of 
animals  Vaccine / 
batch  Concentrati
on of active 
component 
[µg/animal]  Immunization 
day Dose 
volume 
[µL] / 
route  Blood 
collection 
day End 
of 
study  
day 
1 8 Buffer  - 0 20 / i.m.  7, 14, 21, 
28 28 
2 8 BNT162b2
/RBP 020.2 0.2 0 20 / i.m.  7, 14, 21, 
28 28 
3 8 BNT162b2
/RBP 020.2 1 0 20 / i.m.  7, 14, 21, 
28 28 
4 8 BNT162b2
/RBP 020.2 5 0 20 / i.m.  7, 14, 21, 
28 28 
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708949
  
 
R&D Report R -20-0085 Version 0 4 Page 15 of 93 
  Strictly Confidential  
4 MATERIALS AND METHODS  
4.1 Test Item  
BNT162 b2, animal trial material  (ATM): For CoAs see Appendix  2: Certificates of 
Analysis . 
 RNA batch : RNA -RF2003 21-06 
 Polymun batch RB P020.2 LNP with the lot: CoVVAC/ 270320  
4.2 Control Item  
 PBS+300  mM sucrose (from Polymun)  
4.3 Test System  
 32 female BALB/c mice at an age of 9 weeks at stud y start.  
4.4 Materials  
Table  2: Materials  
Product name  Application/  
specification  Article no.  Working 
dilution  Provider  
15 mL/50 mL tube  Conical bottom, PP, 
30/115 MM,  CELLSTAR®  188271/ 
227261  N/A Greiner Bio -One 
GmbH  
2 mL tube  CRYO.S, round bottom  122278  N/A Greiner Bio -One 
GmbH  
2-Mercaptoethanol  50 mM 31350 -010 N/A Gibco  
8-channel manifold  Polypropylene  BR704526 -
1EA N/A Sigma -Aldrich 
Chemie GmbH  
96-well flat -bottom 
plate  pVNT  655160  N/A Greiner  
96-well microplate  Clear round bottom TC -
treated microplate, with 
lid, sterile  3799  N/A Corning Holding 
GmbH  
96-well V -bottom plate  pVNT  651180  N/A Greiner  
AffiniPure goat anti-
mouse IgG  SPR 115-005-071 N/A Jackson 
ImmunoResearch  
Alexa Fluor® 488 anti -
mouse TNF - 
antibody, clone MP6 -
XT22  ICS 506313  1:100  BioLegend  
Amine coupling kit  SPR BR100050  N/A GE Healthcare  
Ammonium chloride  NH 4Cl A0988,5000  N/A AppliChem GmbH  
Anti-rat/hamster Ig, 
κ/negative control 
(FBS*)  Compensation Particles 
Set 552845  
component 
no. 51-90-
9000949  1 drop  BD 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708950
  
 
R&D Report R -20-0085 Version 0 4 Page 16 of 93 
  Strictly Confidential  
Product name  Application/  
specification  Article no.  Working 
dilution  Provider  
Anti-VSV-G antibody  Clone 8G5F11  EB0010  N/A Kerafast  
APC anti -mouse IL -2 
antibody  ICS 503810  1:100  BioLegend  
BD Pharmingen™ 
purified rat anti-mouse 
CD16/CD32  Mouse BD Fc Block™ 
(2.4G2)  553142  1:100  BD 
Blocker™ bovine 
serum albumin ( BSA) 
in PBS  (10×) ICS 7011150  1× ThermoFisher  
Brilliant Violet 510™ 
anti-mouse CD4 
antibody  ICS 100559  1:200  BioLegend  
Brilliant Violet 711™ 
anti-mouse IL -4 
antibody  ICS 504133  1:200  BioLegend  
Brilliant Violet 785™ 
anti-mouse CD25 
antibody PC61  ICS 102051  1:200  BioLegend  
BV421 rat anti -mouse 
CD8a antibody  ICS 100753  1:200  BioLegend  
Capillary pipettes  minicaps®, blood 
sampling,  4 µL/10  µL, not 
heparinized  9000104/  
9000110  N/A Hirschmann 
Laborgeräte 
GmbH & Co.KG  
Casein blocking buffer 
10× ELISA  B6429 -
500ml  N/A Sigma -Aldrich 
Chemie GmbH  
CM5 sensor chip  SPR BR100012  N/A GE Healthcare  
Combitips advanced®  Biopur®, 50  mL 0030089693  N/A Eppendorf 
Vertrieb 
Deutschland 
GmbH  
Concanavalin A  From Canavalia 
ensiformis  (Jack bean, 
5 mg),Type IV -S, 
lyophilized  C0412 -5MG  N/A Sigma -Aldrich 
Chemie GmbH  
Cover films  ELISA  RATI601841
0 N/A VWR International 
GmbH  
Dimethyl sulfoxide  
(DMSO)  For cell culture  A3672,0100  N/A AppliChem GmbH  
DPBS  No calcium, no 
magnesium  14190 -094 1 × Thermo Fisher 
Scientific  
Easystrainer 70  µm For 50  mL tubes  542070  N/A Greiner Bio -One 
GmbH  
eBioscience™ Fixable 
Viability Dye eFluor™ 
780 ICS 65-0865 -18 1:1,000 ThermoFisher  
Eppendorf safe -lock 
tubes  0.5 mL/ 1.5  mL/ 2.0  mL/ 
5.0 mL, Eppendorf 
Quality™  0030121023
/003012008
6/00301200
94/0030119
401 N/A Eppendorf 
Vertrieb 
Deutschland 
GmbH  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708951
  
 
R&D Report R -20-0085 Version 0 4 Page 17 of 93 
  Strictly Confidential  
Product name  Application/  
specification  Article no.  Working 
dilution  Provider  
Ethylenediaminetetraa
cetic acid solution  EDTA  03690 -
100ML  N/A Sigma -Aldrich 
Chemie GmbH  
Fetal bovine serum  
(FBS)  Non-USA origin, sterile -
filtered  F7524  N/A Sigma -Aldrich 
Chemie GmbH  
Filtration unit for 
medium flasks  High Performance, PES, 
0.45 µm, 1 ,000 mL 514-0301  N/A VWR International 
GmbH  
Goat anti -mouse IgG 
(POX)  Whole IgG Fc y fragment, 
secondary antibody, IgG 
isotype -specific ELISA  115-035-071 1:15,000 Jackson 
ImmunoResearch 
via Dianova  
Goat anti-mouse IgG 
HRP  ELISA  115-035-071 1:15,000 Jackson 
Immu noResearch  
Goat anti -mouse IgG1 
(HRP)  IgG1 Fc y subtype -
specific , secondary 
antibody, IgG isotype -
specific ELISA  115-035-205 1:5,000 Jackson 
ImmunoResearch 
via Dianova  
Goat anti -mouse 
IgG2 a (HRP)  IgG2 a Fc y subtype -
specific  secondary 
antibody, IgG isotype -
specific ELISA  115-035-206 1:5,000 Jackson 
ImmunoResearch 
via Dianova  
Goat anti-rabbit IgG 
HRP  ELISA  A0545 -1ml 1:10,000 Sigma -Aldrich  
GolgiPlug  ICS 555029  1:1,000 BD 
GolgiStop  ICS 554724  1:1,500 BD 
HBS-EP+ buffer 10×  SPR BR100669  N/A GE Healthcare  
HEPES  1 M 15630 -056 N/A Gibco  
Human SARS 
coronavirus spike S1 
subunit antibody  
Anti-COVID -19-S1 
Isotype: rabbit IgG  ELISA  40150 -RP01  S1: 
1:1,000 
RBD: 
1:2,000 Sino Biological  
Insulin syringes  BD Micro -Fine™+, 30  G, 
0.3 mL  324826  N/A Becton Dickinson 
GmbH  
Ionomycin  ICS I9657  1 µg/m L Sigma  
Isoflurane  Anesthesia  9714675  N/A Piramal Critical 
Care  
Isotonic saline  Injection solution  06173569  N/A Fresenius Kabi  
Deutschland 
GmbH  
Lipofectamine® LTX & 
PLUS™  Transfection reagent  15338 -100 N/A Invitrogen  
MACS LS columns  MACS  130-042-401 N/A Miltenyi Biotec  
MACS® MicroBeads  CD8a (Ly -2)/CD4 (L3T4)  130-117-
044/130-
117-043 N/A Miltenyi Biotec  
MaxiSorp plate  ELISA  439454  N/A Thermo Scientific  
MEM non-essential 
amino acids (NEAA) 
solution  100× 11140 -035 1× Gibco  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708952
  
 
R&D Report R -20-0085 Version 0 4 Page 18 of 93 
  Strictly Confidential  
Product name  Application/  
specification  Article no.  Working 
dilution  Provider  
Mouse IFN - 
ELISpotPLUS kit Kit for enumeration of 
cells secreting mouse 
IFN- 3321 -4APT -
2 N/A Mabtech  
Mouse IgG1 -BIOT  Clone 15H6, isotype 
control for IgG-specific 
ELISA  0102 -08 1:100  Southern Biotech 
via Biozol  
Mouse IgG2a -BIOT  Clone HOPC -1, isotype 
control for IgG -specific 
ELISA  0103 -08 1:100  Southern Biotech 
via Biozol  
Mouse IgG -UNLB  ELISA  0107 -01 Starting 
dilution 
1:300  Southern Biotech  
PBS powder  No calcium, no 
magnesium  L182 -10 N/A Merck KGaA  
pcDNA3.1 -derived 
expression plasmid  VSV vector production  V79020  N/A Invitrogen  
PE hamster anti-
mouse CD3e clone 
145-2C11  ICS 553064  1:200  BD 
PE/Cy7 anti -mouse 
IFN- antibody, clone 
XMG1.2  ICS 505826  1:500  BioLegend  
Penicillin -streptomycin  10,000  U/mL  15140 -122 N/A Gibco  
Phosphate -buffered 
saline (PBS), 
powdered  ELISA  0780 -10L N/A VWR International 
GmbH  
Pipette tips  ep Dualfilter T.I.P.S.®, 
PCR clean und sterile, 
0.1–10 µL/2–100 µL/50 –
1,000 µL/50 –
1,250 µL/0.1 –5 mL 0030077512
/003007754
7/00300775
55/0030077
792/003007
7750/00300
78616  N/A Eppendorf 
Vertrieb 
Deutschland 
GmbH  
Phorbol 12 -myristate 
13-acetate (PMA ) ICS P1585  0.5 µg/m
L Sigma  
Potassium 
bicarbonate  KHCO 3 A2375,1000  N/A AppliChem GmbH  
ProcartaPlex assay  Bead -based, 11 -plex 
TH1/T H2 mouse 
immunoassay  EPX110 -
20820 -901 N/A Thermo Fisher 
Scientific  
Recombinant RBD 
protein  
SARS -CoV-2 (2019 -
nCoV) spike protein 
(RBD, Fc Tag)  ELISA  40592 -V02H  100 ng/ 
100 µL SinoBiological  
Reservoir  25 mL, 100  mL 613-
1174/613 -
1171  N/A VWR International 
GmbH  
Roti Histofix, 4%  
formaldehyde  ICS P087.4  2% Carl Roth GmbH 
& Co. KG  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708953
  
 
R&D Report R -20-0085 Version 0 4 Page 19 of 93 
  Strictly Confidential  
Product name  Application/  
specification  Article no.  Working 
dilution  Provider  
RRPMI 1640 medium  GlutaMAX™ supplement  61870 -010 N/A Gibco  
SARS -CoV-2 (2019 -
nCoV) spike antibody, 
rabbit Mab  ELISA  40150 -R007  S1: 
1:500  
RBD: 
1:1,000 Sino Biological  
SARS -CoV-2 (2019 -
nCoV) spike RBD -Fc 
recombinant protein  ELISA  40592 -V02H  100 ng/ 
100 µL Sino Biological  
SARS -CoV-2 (2019 -
nCoV) spike RBD -His 
recombinant protein  SPR 40592 -V08B  N/A Sino Biological  
SARS -CoV-2 (2019 -
nCoV) spike S1 -His 
recombinant protein   ELISA, SPR  40591 -V08H  N/A Sino Biological  
Serological pipettes  5 mL, 10  mL, 25  mL, 
50 mL 606180/607
180/601180/
768180  N/A Greiner Bio -One 
GmbH  
Single -use syringe  Injekt® Solo 5  mL 4606051V  N/A B. Braun 
Melsungen AG  
Sodium bicarbonate  ELISA  S5761  N/A Sigma -Aldrich 
Chemie GmbH  
Sodium carbonate  ELISA  S7795  N/A Sigma -Aldrich 
Chemie GmbH  
Sodium pyruvate  100 mM 11360 -039 N/A Gibco  
Sterile filters  0.45 µm 514-4123  N/A VWR International  
Sulfuric acid 25% 
EMSURE®  ELISA  1007161000  N/A VWR International 
GmbH  
TMB One (3,3’,5,5’-
Tetramethylbenzidin e) 
ready -to-use-solution  ELISA  4380A  N/A Biotrend 
Chemikalien 
GmbH  
Tween 20  ELISA  9127.1  N/A Carl Roth GmbH 
& Co. KG  
Vero -76 cells  Pseudovirus titration  CRL-1587  N/A ATCC  
Vi-CELL™ XR Quad 
Pak For Vi -CELL™  XR Cell 
Viability Analyzer  383722  N/A Beckman Coulter 
GmbH  
VSV-ΔG-GFP vector  VSV vector production  EH1004  N/A Kerafast  
 
Table  3: Equipment  
Product name  Application  Provider  
Biacore T200  SPR analysis  Cytiva  
Vi-CELL™  XR Cell Viability 
Analyzer  Splenocyte count  Beckman Coulter GmbH  
CTL ImmunoSpot S6 Core 
Analyzer  ELISpot plate reader  Cellular Technology Ltd . 
BioTek Epoch reader  ELISA plate reader  BioTek  
IncuCyte Live Cell Analysis 
system  pVNT  Sartorius  
Celesta  Flow cytometry analysis (ICS)  BD 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708954
  
 
R&D Report R -20-0085 Version 0 4 Page 20 of 93 
  Strictly Confidential  
Table  4: Software  
Product name  Application  Provider  
Biacore T200 Evaluation 
Software  3.1 SPR analysis  Cytiva  
Excel  Animal monitoring , raw data  Microsoft Corp.  
GraphPad  Prism 8  Analysis of ELISpot, ELISA , and pVNT  GraphP ad Software Inc.  
Gen5 software 3.0.9  ELISA plate read out  BioTek  
ImmunoCapture 7.0.7.0   ELISpot analysis  Cellular Technology Ltd . 
ImmunoSpot® analysis 
software version 5 7.0.17.0  ELISpot analysis  Cellular Technology Ltd . 
IncuCyte Live Cell Analysis 
system  pVNT  Sartorius  
BD FACSDiva software 
version 8.0.1.1  Flow cytometry analysis (ICS)  BD 
 
Table  5: Peptide pools for stimulation of splenocytes  for ELISpot assays  
S protein -specific peptides  
Name  Sequence  
2019 -nCoV S.wt  
With a total of 315 
overlapping peptides 
(Format 15/11)  
GenBank: QHD43416.1  
Batch: 43000LHB -1 and 
43000LHB -2 
 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQ
DLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWI
FGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEF
RVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPI
NLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSS GWTAGAA
AYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTS
NFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLY
NSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYN
YKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQA
GSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVV LSFELLHAPATVCG
PKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRD
PQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPT
WRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRA
RSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSMTKTSVDCT
MYICGDSTECSNLLLQYGSFCTQLNRALT GIAVEQDKNTQEVFAQVKQIYKTP
PIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAA
RDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVN
QNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTY
VTQQLIRAAEIRASANL AATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHG
VVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYE
PQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVD
LGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLG
FIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHY
T 
RBD -specific peptides  
Name  Sequence  
2019 -nCoV RBD  
With a total of 48 
overlapping peptides 
(Format 15/11)  VRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKC
YGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGC
VIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVE
GFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPK  
Irrelevant peptide control  
Name  Sequence  
AH-1 SPSYVYHQF  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708955
  
 
R&D Report R -20-0085 Version 0 4 Page 21 of 93 
  Strictly Confidential  
4.5 Methods  
4.5.1  Animal Care  
4.5.1.1  General Information  
BALB/c mice were delivered at the age of at least six weeks. Delivered mice were used 
for experiments after approximately one week of acclimatization. All experiments and 
protocols were approved by the loc al authorities (local animal welfare committee), 
conducted according to the Federation of European Laboratory Animal Science 
Associations (FELASA ) recommendations and in compliance with the German animal 
welfare act and Directive 2010/63/EU. Only animals w ith an unobjectionable health 
status were se lected for testing procedures.  
All animals were registered upon arrival in the lab animal colony management system 
PyRAT (Scionics  Computer Innovation GmbH, Dresden, Germany) and tracked until 
death. Each cage was labeled with a cage card indicating the mouse strain, sex, date 
of birth , and number of animals per cage. At the start of an experiment additional 
information was added suc h as the project and license number, the start of the 
experiment and details on interventions. Where necessary for identification, animals 
were arbitrarily numbered with earmarks.  
4.5.1.2  Housing Condition s and Husbandry  
Mice were housed at BioNTech SE ’s animal fa cility (An der Goldgrube 12, 55131 
Mainz) under barrier and specific -pathogen -free (SPF) conditions in individually 
ventilated cages (Sealsafe GM500 IVC Green Line, TECNIPLAST, Hohenpeißenberg, 
Germany; 500  cm²) with a maximum of five animals per cage. The  temperature and 
relative humidity in the cages and animal unit w ere kept at 20 -24°C and 45 -55%, 
respectively, and the air change (AC) rate in the cages was 75 AC/h. Cages contained 
dust-free bedding made of debarked chopped aspen wood (Abedd LAB & VET Ser vice 
GmbH, Vienna, Austria, product code: LTE E -001) and additional nesting material w as 
changed weekly. Autoclaved ssniff M -Z food (sniff Spezialdiäten GmbH, Soest, 
Germany; product code: V1124) and autoclaved tap water were provided ad libitum  
and change d at least once weekly. All materials were autoclaved prior to use.  
4.5.2  Animal Monitoring  
Routine animal monitoring was carried out daily and included inspection for dead mice 
and control of food and water supplies. The health of e ach mouse was closely 
assesse d at least once weekly  and the results documented in health monitoring sheets  
(see Appendix  1: Animal Monitoring - Observations ). The general physical c ondition of 
the mice was assessed according to the following parameters:  
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708956
  
 
R&D Report R -20-0085 Version 0 4 Page 22 of 93 
  Strictly Confidential  
 Body weight change  
 Macroscopic assessment of activity level/behavior  
 Macroscopic assessment of general discomfort: drop in body temperature 
determined by touch and by visual inspection of ears and paws (ears and paws 
appear pink in a healthy mouse, white in a mouse with discomfort indicate s 
reduced blood circulation ) 
 Macros copic assessment of fur condition and appearance of eyes, inspection 
of body cavities/fluids  
 Macroscopic assessment of irregularities in breathing ability  
 Indication of pain  
 Macroscopic assessment for signs of automutilation and /or fighting  
Details on anim al monitoring criteria are shown in  Appendix  1: Animal Monitoring - 
Observations , Table  9. 
4.5.3  Animal Treatment  
4.5.3.1  Treatment Schedule, Route of Administration, and Dose  
The test compound was administered i.m. once at three different doses ( 0.2 µg, 1 µg, 
or 5 µg per anima l) to the three test groups of mice on day  0. The control group was 
treated with buffer alone.  
4.5.3.2  Immunization  
Following  anesthesia  by inhalation of 2.5% isoflurane in oxygen , the injection site on 
the hind leg  of the mouse  was shaved  for immunization . Buffer or dissolved test item 
was applied i.m. i nto the musculus gastrocnemius  in a volume of 20  µL. After 
immunization and a short recovery phase  from anesthesia , the mice  were o bserved for 
any immediate signs of discomfort due to the immunization procedure.  
4.5.3.3  Blood Sampling via the Retro -Orbital Venous Plexus or 
Vena Facialis  
Blood was sampled via the retro -orbital venous plexus according to SOP -030-074. In 
short, mice were anesthetized by inhalation of 2.5% isoflurane in oxygen and tightly 
held for blood collection . A thin glass capillary (29  G) was ins erted gently through the 
retro-orbital sinus membrane and blood was collected into an appropriate plastic tube 
(Sarstedt, Z -gel included for clotting activation). After careful removal of the glass 
capillary, the restraining hold on the mouse was loosened.  Alternatively, blood 
collection took place via the vena facialis  according to SOP -030-074. In short, without 
prior anesthesia, mice were tightly held for blood collection, and the vena facialis  was 
punctured using a lancet in a precise and short movement.  Blood was collected into 
an appropriate plastic tube (Sarstedt, Z -gel included for clotting activation), and then 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708957
  
 
R&D Report R -20-0085 Version 0 4 Page 23 of 93 
  Strictly Confidential  
the restraining hold on the mouse was loosened. Blood samples were centrifuged at 
10,000 ×g and RT for 5  min and serum transferred to a pre -labeled 0.5  mL reagent 
tube for use in subsequent downstream assays or storage at -20°C.  
4.5.4  Endpoint of Experiment/Termination Criteria  
Animals were euthanized in accordance with §4 of the German animal w elfare act and 
the recommendation of the German Society of Laboratory Animal Science  (GV-
SOLAS ) by cervical di location or by e po ure to carbon dio ide  Additionally, 
termination criteria were applied according to the specification within the respective 
animal test approval as listed below. Body weight losses exceeding 20%, or a high 
severity level in any of the parameters found in Section 4.5.2  were o n their own 
sufficient reason for immediate euthanasia.  
4.5.4.1  Dissection of Animals and Organ Collection  
Following euthanasia, mice were disinfected with 70% ethanol and the dissection was 
performed starting with an abdominal incision. The spleen was collected a nd stored in 
DPBS on ice for subsequent splenocyte preparation.  
4.5.5  ELISA  
Serum samples were tested in 96 -well plates for their S -specific antibody concentration 
based on  SOP -030-112 (with minor modifications as described below) . Briefly, for the 
time points 7, 14 , and 21 days after immunization, a screening analysi s was performed 
and for day 14 and 28, serum samples were analyzed by endpoint titration.  
1. Coat each well of a Maxi Sorp plate with 100  ng/100  µL rec ombinant  protein per 
well or iso type controls according to plate layout . 
 Coating buffer: 50  mM sodium carbonate b uffer (1 .696 g Na 2CO 3 + 
2.856 g NaHCO 3, top up to 1 L distilled H 2O, pH 9.6 (pH adjustment not 
needed )) 
2. Cover plates and incubate at 4°C o/n . 
3. Wash three times with 300  µL/well PBS with Twee n (PBS-T). 
4. Block all wells with 1xBB, 250  µL/well . 
5. Incubate at 37°C for 1  h on shaker . 
6. Wash three times with 300  µL/well PBS -T. 
7. Dilute primary  antibodies  (samples and positive control) according to schedule . 
8. Incubate at 37°C for 1  h on shaker . 
9. Wash three times with 300  µL/well PBS -T. 
10. Dilute the secondary antib odies according to calculations.  
11. Incubate at 37°C for 45  min on shaker . 
12. Wash three times with 300  µL/well PBS -T. 
13. Add 100  µL/well TMB substrat e. 
14. Incubate 8  min at RT (clear ->blue) . 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708958
  
 
R&D Report R -20-0085 Version 0 4 Page 24 of 93 
  Strictly Confidential  
15. Stop the reaction wi th 100  µL 25% sulf uric acid. (blue -> yellow) . 
16. Read on plate reader (450  nm, reference: 620  nm). 
For concentration analysis, the signal of the specific samples was correlated to the 
isotype control.  For analysis of IgG subtypes, the mean ΔOD 450 -620 nm per  group 
was calculated and the ratio of IgG2 a:IgG1 ratio was calculated.  
For reciprocal serum endpoint titer, the serum dilution that emitted the OD exceeding 
4-fold background was used. The background was defined as the OD signal given by 
the recombinant p rotein incubated with the secondary detection anti -mouse IgG 
antibody only.  
4.5.6  Surface Plasmon Resonance Spectroscopy  
Binding kinetics of murine S1 - and RBD -specific serum IgGs was determined using a 
Biacore T200 device with HBS -EP running buffer at 25°C. Car boxyl groups on the CM5 
sensor chip matrix were activated with a mixture of 1 -ethyl -3-(3-dimethylaminopropyl) 
carbodiimidehydrochloride (EDC) and N -hydroxysuccinimide (NHS) to form active 
esters for the reaction with amine groups. Anti -mouse -Fc-antibody wa s diluted in 
10 mM sodium acetate buffer pH  5 (30  µg/mL) for covalent coupling to immobili zation 
level of ~10,000 response units (RU). Free NHS  esters on the sensor surface were 
deactivated with ethanolamine.  
Mouse serum was diluted 1:50 in HBS -EP buffer and applied at 10 µL/min for 30 
seconds to the active flow cell for capture by immobili zed antibody, while the reference 
flow cell was treated with buffer. Binding analysis of captured murine IgG antibodies to 
S1-His or RBD -His was performed using a multi -cycle kinetic method with 
concentrations ranging from 25 to 400  nM or 1.5625 to 50  nM, respectively. An 
association period of 180 seconds was followed by a dissociation period of 
600 seconds with a constant flow rate of 40  μL/min and a final regeneration s tep. 
Binding kinetics were calculated using a 1:1 Langmuir global kinetic fit model.  
4.5.7  Pseudovirus -based Neutralization Test  
For analyzing the amount of functional nAbs in the serum samples, pVNTs were 
performed.  
4.5.7.1  Production of SARS -CoV-2-S Pseudotyped  VSV Vector  
Replication -deficient vesicular stomatitis virus (VSV) that lacks the genetic information 
for the VSV envelope glycoprotein VSV -G but contains an open  reading frame (ORF) 
for green fluorescent protein (GFP) was used for SARS -CoV-2-S pseudovirus  
generation. VSV pseudotypes were generated according to a published protocol 
(Hoffmann et  al. 2020 ). 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708959
  
 
R&D Report R -20-0085 Version 0 4 Page 25 of 93 
  Strictly Confidential  
In brief, HEK293T/17 cells cultured in DMEM supplemented with 10% FBS were 
transfected with a pcDNA3.1 -derived expression plasmid (Invitrogen) coding for the 
SARS -CoV-2 spike protein (GenBank ID: QHD43416.1) with shortened cytoplasmic 
tail, i.e. , pSARS -CoV-2-S-CΔ19, using Lipofectamine® LTX & PLUS™ Reagent 
(Invitrogen) following the manufacturer’s instructions. The cytoplasmi c tail was 
truncated for the 19 C -terminal amino acids to facilitate a more efficient integration of 
SARS -CoV-2-S into VSV virions analogous to SARS -CoV-2-S pseudotyped VSV 
(Fukushi et  al. 2005 ). At 24  h post transfection, ce lls were inoculated with VSV -G 
transcomplemented VSV -ΔG-GFP vector (Indiana strain, de novo  generated by 
reverse genetics from plasmid ( Lawson et  al. 1995 )) at a multiplicity of infection (MOI) 
of three and incubated for 2  h at 37°C and 5% CO 2. Next, the inoculum was removed, 
cells were washed with PBS, and standard culture medium which contained 0.5  µg/mL 
anti-VSV-G antibody (clone 8G5F11) was added to neutralize residual input virus. 
Twenty -four hours after infection, VSV/SA RS-CoV-2-S pseudovirus -containing 
supernatants were harvested, filtered (0.45 µm) and stored at -80°C in aliquots until 
further use.  
4.5.7.2  Titration of VSV/ SARS -CoV-2-S Pseudovirus  
For titration of VSV/SARS -CoV-2-S pseudovirus, Vero -76 cells (ATCC) were thawed 
according to SOP -030-041, diluted to 2.67  × 105 cells/mL in assay medium (DMEM  
and 10% FBS) and seeded in 96 -well flat -bottom plates at 4  × 104 cells per well. Cells 
were incubated for 4 to 6  h at 37°C and 7.5% CO 2. Meanwhile, two -fold, eight -step 
serial di lutions were prepared in 96 -well V -bottom plates beginning with undiluted 
pseudovirus supernatant. Vero -76 wells were inoculated with 50  µL of the diluted 
pseudovirus supernatant and incubated for 16 to 24  h at 37°C and 7.5% CO 2. Each 
dilution was tested i n duplicate wells. After the incubation, the cell culture plates were 
removed from the incubator, placed in an IncuCyte Live Cell Analysis system (Essen 
Bioscience) and equilibrated for 30  min prior to the analysis. Whole well scanning for 
brightfield and GFP fluorescence was performed using a 4× objective. The number of 
infected GFP -fluorescent cells per well was plotted as a function of pseudovirus 
supernatant dilution using GraphPad Prism. Data (x = logx) were fitted with linear 
regression and the derive d slope and y -intercept used to calculate the amount of viral 
supernatant needed to obtain 144 infected cells/96 -well (20% excess for virus 
neutralization test included) . 
4.5.7.3  Pseudovirus -based Neutralization Test  
Sera from blood samples collected 14, 21 and 28  days after immunization were tested 
using the VSV/SARS -CoV-2-S pseudovirus neutralization test (pVNT). For the pVNT 
assay, Vero -76 cells were thawed according to SOP -030-041, diluted to 2.67  × 105 
cells/mL in assay medium (DMEM and 10% FBS) and seeded in 96-well flat -bottom 
plates at 4  × 104 cells per well. Cells were incubated for 4 to 6  h at 37°C and 7.5% 
CO 2. Initial dilutions of mouse serum samples were prepared by adding 10  µL of serum 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708960
  
 
R&D Report R -20-0085 Version 0 4 Page 26 of 93 
  Strictly Confidential  
to 50  µL assay medium in a 96 -well V -bottom plate. Seven additiona l dilutions were 
subsequently prepared in two -fold dilution steps, by iteratively transferring 30  µL of 
diluted sera to wells containing 30  µL assay medium. VSV/SARS -CoV-2 pseudovirus 
was thawed and diluted to obtain 120 infected cells/25  µL (4.8  × 103 infectious units 
[IU]/mL). 30  µL of diluted pseudovirus (corresponds to 144 infected cells; see 
Section  4.5.7.2 ) was added to the wells containing the serum dilution series. 
Pseudovirus/serum dilution mix was incubated for 5  min at RT on a microplate shaker 
at 750  rpm, and additional 5  min at RT without  agitation. Pseudovirus/serum dilution 
mix was then added to the seeded Vero -76 cells (50  µL mix per well, MOI:0.003), 
followed by incubation for 16 to 24  h at 37°C and 5% CO 2. Each dilution of serum 
samples was tested in duplicate wells. Vero -76 cells inc ubated with pseudovirus in the 
absence of mouse sera were used as positive controls. Vero -76 cells incubated without 
pseudovirus were used as negative controls. After the incubation, the cell culture plates 
were removed from the incubator, placed in an Inc uCyte Live Cell Analysis system and 
incubated for 30  min prior to the analysis. Whole well scanning for brightfield and GFP 
fluorescence was performed using a 4× objective. To calculate the neutralizing titer, 
infected GFP -positive cell number per well was  compared with the no -serum 
pseudovirus positive control. Mean values of the no -serum pseudovirus positive control 
multiplied by 0.5 represent the pseudovirus neutralization 50% (pVN 50); mean values 
of the no -serum pseudovirus positive control multiplied b y 0.1 represent the 
pseudovirus neutralization 90%. Serum samples with mean values below this cut -off 
exhibit >50% or >90% virus neutralization activity, respectively . 
4.5.8  Preparation of Splenocytes  
The single cell suspensions from collected spleens were prepa red according to SOP -
030-078. To this end, the spleens were squeezed through 70  µm cell meshes using 
the plunger of a syringe to release the splenocytes into a tube. Splenocytes were 
washed with an excess volume of DPBS followed by centrifugation at 300  × g for 6  min 
at RT and discarding the supernatants. Erythrocytes were then lysed with erythrocyte 
lysis buffer (154  mM NH 4Cl, 10  mM KHCO 3, 0.1  mM EDTA) for 5  min at RT. The 
reaction was stopped with an excess volume of DPBS. After another washing step, 
cells were resuspended in medium (10% FB S, 1% NEAA, 1% sodium pyruvat e, 0.5% 
penicillin/streptomycin), passed through a 70  µm cell mesh again, counted according 
to SOP -010-028, and stored short -term at 37°C for use on the same day or frozen in 
liquid nitrogen , resuspended in 1  mL FBS/10% DMSO . For the use of f rozen 
splenocytes  in ELISpot analysis  after thawing, the amount of cells per well  was doubled  
(1 × 106 cells). Immediately after thawing, pre -warmed (RT) PBS was  added  to 
splenocytes. Two washing steps using pre-warmed PBS to remove DMSO from 
freezing process  were performed and splenocytes were counted according to SOP -
010-028. Splenocytes were stored short -term at 37°C for further use . 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708961
  
 
R&D Report R -20-0085 Version 0 4 Page 27 of 93 
  Strictly Confidential  
4.5.9  ELISpot A ssay  
ELISpot assays with fresh or frozen splenocytes were performed according to SOP -
030-110 (with m inor modifications as described below) using the mouse IFN - 
ELISpotPLUS kit. Briefly, 96 -well ELISpot plates were washed with PBS and blocked 
with medium for at least 30  min at 37°C. 100  µL of the  splenocyte  solution ( fresh cells: 
5 × 105 cells; frozen cells: 1  × 106 cells) were transferred to the respective well of the 
96-well ELISpot plate. Another  100 µL of overlapping peptide pools  or controls were  
added in the following concentrations:  
 overlapping peptide mix PepMix™ against SARS -CoV-2 S.wt: 0.1 µg/mL final 
concentration per peptide  
 overlapping peptide mix PepMix™ against SARS -CoV-2 RBD: 0. 1 µg/mL final 
concentration per peptide  
 irrelevant peptide (AH -1): 4 µg/mL  
 Concanavalin  A (ConA): 2  µg/mL  
For positive control, the splenocytes were stimulated with ConA, for a non -stimulation 
control only medium was added and as a negative control to detect unspecific 
background signals, the irrelevant peptide was added (AH -1). Plates were incubated 
overnight in a 37°C humidified incubator with 5% CO 2 and after approximately 18  h, 
cells were removed from the plates and the detection protocol of spots was initiated. 
To this end, the detection antibody, Streptavidin -ALP, and  the ready -to-use substrate 
were added to the wells according to the manufacturer’s protocol. After plate drying for 
2–3 h under the laminar flow, an ELISpot plate reader (ImmunoSpot® S6 Core 
Analyzer, CTL) was used to count and analyze spot numbers per well.  
4.5.9.1  Subtyping of CD8+ versus CD 4+ T-cell Responses  
This method was performed with fresh splenocytes (non -frozen). CD8+ or CD4+ T cells 
were isolated from splenocyte cell suspensions using MACS® MicroBeads (CD8a 
(Ly-2) or CD4 (L3T4)) according to the manufacturer’s instructions. Labeled cells were 
eluted from MACS LS columns, centrifuged (5  min at 460  ×g) and taken up at a 
concentration of 1  × 106 cells/mL in medium. 100  µL of CD8+ or CD4+ T cells were 
subsequently re -stimulated by addition of 50  µL peptide solution (control peptide AH -
1 (2 µg/mL), RBD peptide mix (0. 1 µg/mL per peptide) or S  peptide mix (0.1  µg/mL per 
peptide)) and 50  µL of bone marrow -derived dendritic cells (1  × 106 cells/mL, cells 
were frozen at -80°C prior use and prepared from BALB/c mice according to SOP -030-
080) in  an IFN - ELISpot assay (SOP -030-110). Each condition was tested in 
duplicate.  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708962
  
 
R&D Report R -20-0085 Version 0 4 Page 28 of 93 
  Strictly Confidential  
4.5.10  Luminex Assay  
1 × 106 previously frozen splenocytes in 100  µL DC medium (part of SOP -030-110) 
were transferred to a 96-well flat -bottom cell culture plates. 100  µL of an overlapping 
peptide pool or controls were added in the following concentrations:  
 overlapping peptide mix PepMix™ against SARS -CoV-2 S.wt: 0.1 
or 0.03 µg/mL final concentration per peptide  (equal to 31.5 or 9.6  µg/mL total 
peptide)  
 overlapping peptide mix PepMix™ against SARS -CoV-2 RBD: 0.66 or 
0.2 µg/mL final concentration per peptide  (equal to 31.5 or 9.6  µg/mL total 
peptide)  
 PMA: 1  µg/mL and ionomycin: 2  µg/mL  
The plates were incubated for 48  h and supernatant thereafter was harvested for 
cytokine profil ing. Cytokine concentrations in supernatants of the re-stimulated 
splenocytes were determined using a bead -based, 11 -plex T H1/T H2 mouse 
ProcartaPlex immunoassay according to the manufacturer’s instructions. 
Fluorescence was measured with the Bioplex200 Sys tem (Bio -Rad) and analyzed with 
ProcartaPlex Analyst 1.0 software (Thermo Fisher Scientific).  The following analytes 
were measured: IFN-, IL-12p70 , IL-13, IL-1, IL-2, IL-4, IL-5, IL-6, TNF-, GM-CSF, 
and IL-18. 
4.5.11  Intracellular Cytokine Staining  
Briefly, 5  × 105 fresh splenocytes in 100  µL DC medium (part of SOP -030-110) were 
transferred to 96 -well flat -bottom cell culture plates. Finally, 100  µL of an overlapping 
peptide pool or controls were added in the following concentrations:  
 overlapping peptide mix Pe pMix™ against SARS -CoV-2 S.wt: 0.1 µg/mL final 
concentration per peptide  (equal to 31.5  µg/mL total peptide)  
 overlapping peptide mix PepMix™ against SARS -CoV-2 RBD: 0. 1 µg/mL final 
concentration per peptide  (equal to 4.8  µg/mL total peptide)  
 PMA: 1  µg/mL and ionomycin: 2  µg/mL  
As a non -stimulation control, only medium was added to detect unspecific background 
signals. Plates were incubated for 1  h in a 37°C humidified incubator with 5% CO 2 
before adding a GolgiStop+GolgiPlug. After another 4  h, cells were harvested and 
transferred to a 96 -well, V-bottom plate for flow cytometry staining. After the staining 
procedure, cells were solved in 100  µL FACS buffer (PBS + 0.1% BSA) for flow 
cytometry analysis using a FACS Celesta (BD).  
A detailed protoc ol is presented in  Appendix  5: Detailed ICS Protocol . 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708963
  
 
R&D Report R -20-0085 Version 0 4 Page 29 of 93 
  Strictly Confidential  
4.5.12  Statistical Analysis  
GraphPad Prism 8 Software (La Jolla, USA) was used for statistical analysis an d figure 
generation. All test groups were compared to the buffer control group by a one -way 
analysis of variance ( ANOVA ) on each measurement day  as described in the 
respective results section . For Luminex assays, statistical significance was assessed 
by mi xed-effects analysis/Sidak’s comparison.   
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708964
  
 
R&D Report R -20-0085 Version 0 4 Page 30 of 93 
  Strictly Confidential  
5 RESULTS  
5.1 ELISA  
5.1.1  Whole IgG ELISA  
IgGs against recombinant S1  protein or RBD were detected by ELISA  analysis  in 
serum samples obtained on study days 7, 14 , and 21. Statistical significance was 
assessed by one -way ANOVA and Dunnett ’s multiple comparison s test. 
Before immunization, no S1  protein - or RBD -specific IgGs were detected (Pre -
treatment, Figure  2, Figure  3). Treatment with BNT162 b2 induced the formation of 
IgGs specific for S1  protein and RBD, while these  antibodies were not detected in 
samples from buffer control animals independent of the day of sample collection. A 
dose -dependent increase in S1 -specific IgGs was observed on all study days 
(Figure  2), with statistically significant differences between the treatment groups and 
the buffer control group ( p < 0.0001 for all doses and test days ). 
 
Figure  2: ELISA screening analysis on days 7, 14 , and 21 against the recombinant S1 protein  
ELISA was performed using serum samples collected on days 7, 14 , and 21 after immunization to analyze antibody 
responses.  The serum samples were tested against the S1 protein . Individual ΔOD values for each mouse 
(measured in duplicates) are shown by dots; group mean values are indicated by horizontal bars (±SEM).  
**** p < 0.0001 . 
0123
Pre-treatment (1:300) S1OD (450-620nm)
Buffer 0.2 µg 1 µg 5 µg0123
Day 7 (1:900) S1
BNT162b2 (RBP020.2)
Buffer 0.2 µg 1 µg 5 µg0123
Day 14 (1:900) S1
BNT162b2 (RBP020.2)OD (450-620nm)
Buffer 0.2 µg 1 µg 5 µg0123
Day 21 (1:900) S1
BNT162b2 (RBP020.2)**** **** ****
**** **** ******** **** ****
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708965
  
 
R&D Report R -20-0085 Version 0 4 Page 31 of 93 
  Strictly Confidential  
All test g roups showed a statistically significant increase in RBD -specific IgGs  
compared to buffer control ( Figure  3; p < 0.0001 for all doses and test days ). 
 
Figure  3: ELISA screening analysis on days 7,  14, and 21 against the recombinant RBD  
ELISA was performed using serum samples collected on days 7, 14 , and 21 after immunization to analyze antibody 
responses.  The serum samples were tested against the receptor -binding domain (RBD) . Individual ΔOD values  for 
each mouse (measured in duplicates) are shown by dots; group mean values are indicated by horizontal bars 
(±SEM).  **** p < 0.0001 . 
 
ELISA endpoint titration was performed on day 28 after immunization to analyze 
antibody responses ( Figure  4A, B). 
Antibody concentrations in the serum samples were calculated for the individual 
sampling days and the kinetics of IgGs against S1 and RBD proteins is shown in  
Figure  5. Antibody concentrations against S1 (Figure  5A) and RBD (Figure  5B) 
increased  in a dose -dependent manner  over time in the test groups. Statistical 
significance of the differences in IgG concentrations between the test groups and the 
control group was assesse d by one -way ANOVA with Dunnett’s multiple comparison 
post-test on day 28.  
0123
Pre-treatment (1:300) RBDOD (450-620nm)
Buffer 0.2 µg 1 µg 5 µg0123
Day 7 (1:900) RBD
BNT162b2 (RBP020.2)
Buffer 0.2 µg 1 µg 5 µg0123
Day 14 (1:900) RBD
BNT162b2 (RBP020.2)OD (450-620nm)
Buffer 0.2 µg 1 µg 5 µg0123
Day 21 (1:900) RBD
BNT162b2 (RBP020.2)**** **** ****
**** **** **** **** **** ****
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708966
  
 
R&D Report R -20-0085 Version 0 4 Page 32 of 93 
  Strictly Confidential  
The differences in concentrations of IgGs against S1  and RBD  in the test groups 
compared to the buffer control group were statistically significant ( S1: p = 0.0259 for 
0.2 µg, p  < 0.0001 for 1  µg and 5  µg; RBD: p  = 0.0072 for 0.2  µg, p  < 0.0001 for 1  µg 
and 5  µg) on day 28.  
 
 
Figure  4: ELISA endpoint titration on day 28  
Endpoint titration was performed on day 28 after immunization to analyze antibody respons es. The serum samples 
were tested against the S1 protein (A) and RBD (B). Group mean values (±SEM) are shown.  
  
1:300 1:9001:2700 1:81001:24300 1:729001:218700uncoated 0123
S1-ELISA
serum dilutionOD (450-620nm)
Buffer control
0.2 µg BNT162b2 (RBP020.1)1 µg BNT162b2 (RBP020.1)
5 µg BNT162b2 (RBP020.1)
1:300 1:9001:2700 1:81001:24300 1:729001:218700uncoated 0123
RBD-ELISA
serum dilutionA B
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708967
  
 
R&D Report R -20-0085 Version 0 4 Page 33 of 93 
  Strictly Confidential  
 
Figure  5: Kinetics of the antibody concentration against the viral antigen  
For individual ΔOD values, the antibody concentration s in the serum sample s were  calculated. The serum samples 
were tested against (A) the S1 protein and (B) RBD. Group mean antibody concentrations are shown (±SEM) . 
 
Furthermore, to calculate  the reciprocal serum endpoint titer  of antibodies  we 
performed an  endpoint titration for day 14 and 28 samples after immunization 
exceeding the previously shown dilution steps (Figure  6A, B). 
The r eciprocal serum endpoint titer was defined as the first highest dilution step which 
emitted an OD exceeding the background signal four -times as  shown . Reciprocal 
serum endpoint tite r against S1 ( Figure  7A) and RBD ( Figure  7B) were high already 
14 days after immunization and increased  in a dose -dependent manner over time in 
the test groups. Statistical significance of the differences in IgG concentrations 
between the test groups and the control group was assessed by a one-way AN OVA 
with Tukey’s  multiple comparison post -test. 
The differences in titers  of IgGs against S1 and RBD in the test groups compared to 
the buffer control group were statistically significant (S1 , day 28 : p = 0.0082 for 1 µg, 
p < 0.0001 for 5 µg; RBD , day 14 : p < 0.0001 for 5  µg and day 28 : p = 0.0109 for 1 µg, 
p < 0.0001 for 5  µg). 
Buffer
0.2 µg
1 µg
5 µg
pre d7 d14 d21 d280100200300400500
IgG concentrations S1
BNT162b2 (RBP020.2)IgG [µg/mL]
pre d7 d14 d21 d280200400600
IgG concentrations RBD
BNT162b2 (RBP020.2)Buffer
0.2 µg
1 µg
5 µgA B
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708968
  
 
R&D Report R -20-0085 Version 0 4 Page 34 of 93 
  Strictly Confidential  
 
Figure  6: ELISA endpoint titration  (long titration)  
Endpoint titration against the S1 protein (A) and RBD (B)  was performed on day  14 (left) and 28 (right) after 
immunization to analyze reciprocal serum endpoint titer of antibodies . Group mean values (±SEM) are shown ; 
samples were measured in duplicates . Background was defined as the OD value of the recombinant protein 
incubated with the secondary anti-mouse IgG detection antibody only and included in the graphs (blue dotted line; 
n = 8). 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708969
  
 
R&D Report R -20-0085 Version 0 4 Page 35 of 93 
  Strictly Confidential  
 
Figure  7: Reciprocal serum endpoint titer at day 14 and 28 after immunization  
For individual OD values, the reciprocal serum endpoint ti ter was calculated. The serum samples were tested 
against (A) the S1 protein and (B) RBD. Group mean titer are shown (±SEM) . Significance compared to buffer 
control is included, * p ≤ 0.05, ** p ≤ 0.01, ****  p < 0.0001 ; LDL  = lower detection limit.  
 
5.1.2  IgG Subtype -specific ELISA  
IgG1 and IgG2 a subtypes of anti -S1 antibodies were analyzed  by IgG subtype -specific 
ELISA  in serum samples obtained on study day 28. Statistical significance was 
assessed by one -way ANOVA followed by a Dunnett ’s multiple comparison post -test. 
Treatment with BNT162 b2 induced the formation of IgG1 and IgG2 a specific for 
S1 protein, while these antibodies were not detected in samples from buffer control 
animals independent of the day of sample collection (Figure  8). 
On day 28, all dose groups displayed significantly higher group mean ΔOD values for 
IgG1 and IgG2 antibodies than the control animals ( IgG1: p < 0.0001 for all doses, 
IgG2a: p  = 0.0020 for 0.2  µg, p  < 0.0001 for 1  µg and 5  µg). 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708970
  
 
R&D Report R -20-0085 Version 0 4 Page 36 of 93 
  Strictly Confidential  
 
Figure  8: IgG subtype -specific ELISA on day 28  
ELISA was performed using  serum samples collected on day  28 after immunization to analyze  (A) IgG1 and  (B) 
IgG2 a responses. The serum samples were tested against the S1 protein . Individual ΔOD values for each mouse 
(measured in duplicates) are shown by dots; group mean values are indicated by horizontal bars (± SEM).  
** p ≤ 0.01, ****  p < 0.0001.  
 
ELISA endpoint  titration was performed on day 28 after immunization to analyze IgG1 
and IgG2 a responses ( Figure  9A, B). 
 
 
Figure  9: ELISA endpoint titration on day 28  (IgG subtypes)  
Endpoint titration was performed on day 28 after immunization to analyze IgG1 (A) and IgG2 a (B) responses. Group 
mean values (±SEM) are shown.   
Buffer 0.2 µg 1 µg 5 µg0123
Day 28 (1:2700) IgG1
BNT162b2 (RBP020.2)OD (450-620nm)
Buffer 0.2 µg 1 µg 5 µg0123
Day 28 (1:2700) IgG2a
BNT162b2 (RBP020.2)A B
**** **** **** ** **** ****
1:9001:2700 1:81001:24300 1:729001:218700 1:656100 uncoated0123
Day 28, IgG1
serum dilutionOD (450-620nm)Buffer
0.2 µg
1 µg
5 µg
1:9001:2700 1:81001:24300 1:729001:218700 1:656100 uncoated0123
Day 28, IgG2A
serum dilutionBuffer
0.2 µg
1 µg
5 µgA B
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708971
  
 
R&D Report R -20-0085 Version 0 4 Page 37 of 93 
  Strictly Confidential  
5.1.3  IgG2a/IgG1 Ratio 
To analyze the ratio between the two IgG subtypes, the ΔOD values  were used. 
Antibody ratios  in the serum samples were calculated for day 28 (Figure  10). Statistical 
significance was assessed by one -way A NOVA followed by Tukey’s multiple 
comparison post -test to compare all test groups with each other.  
While the two higher doses induced a balanced IgG2a /IgG1  response, the lowest dose 
induced a higher ignal for IgG1 than IgG2a  The difference between the group treated 
with 0.2 µg and the groups treated with 1  µg and 5  µg were statistically significant 
(p = 0.0004  for 0.2 µg vs 1 µg, p = 0.0041 for 0.2  µg vs 5 µg). 
 
 
Figure  10: IgG2a/IgG1 subtype ratio on day 28  
Based on the 1:2 ,700 dilution step (see  Figure  9), the ΔOD the ΔOD for every single sample were used to calculate 
the ratio of IgG2a and IgG1. For this purpose, the ΔOD value of IgG2a was divided by the ΔOD values of IgG1 per 
mouse. Group mean values (±SEM) are shown. The value of “1” in the graph would give the equal signal between 
the two subtypes while ratio > 1 mirror a higher IgG2a subtype d etection.  ** p ≤ 0.01, *** p ≤ 0.001 . 
 
5.2 Binding Kinetics of Antigen -specific IgGs Using SPR  
To obtain kinetic and affinity information about the binding of vaccine -elicited IgG to 
SARS -CoV-2 S1 fragment and RBD, SPR spectroscopy was conducted. Whole IgG 
from ser a (n = 8) generated at 28  days after immunization with 5  µg BNT162b2 was 
captured by high -affinity anti -IgG antibody immobilized on the sensor chip surface . 
Binding analysis of captured murine IgG antibodies to recombinant S1 -His or RBD -His 
protein wa s performed using a multi -cycle kinetic method with concentrations ranging 
from 25 to 400  nM S1 -His or 1.5625 to 50 nM RBD -His. Kinetic parameters  were 
calculated by fitting the sensorgram curves with a 1:1 Langmuir global kinetic fit model.  
0.2 µg 1 µg 5 µg0.00.51.01.5
BNT162b2 (RBP020.2)Ratio (IgG2a/IgG1)*** **
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708972
  
 
R&D Report R -20-0085 Version 0 4 Page 38 of 93 
  Strictly Confidential  
At day 28 after immuniz ation, vaccine -elicited IgG had a strong binding affinity for S1 -
His (geometric mean K D = 12 nM), with affinities ranging from 8.06  nM to 34.5  nM 
across the 8 serum samples tested (Figure  11A, Table  6). Somewhat higher binding 
affinity was detected for RBD -His ( geometric mean K D = 0.99 nM), with affinities 
ranging from 0.48  nM to 2.78  nM (Figure  11A, Table  7). Binding to S1 -His and RBD -
His can be characterized by a comparable  low disso ciation rate constant  (geometric 
mean k off = 4×10-4 s-1 vs. 5.97 ×10-4 s-1). However, association of RBD -His to captured 
IgG was approximately 20 -fold faster (geometric mean k on = 6.02×105 M-1s-1 vs.  
3.33×104 M-1s-1). 
 
Figure  11: Binding affinities of vaccine -elicited IgG for S1 -His and RBD -His protein  
Representative SPR sensorgram of the binding kinetics of recombinant S1 -His (A) and RBD -His protein  (B) to 
immobili zed mouse IgG from serum 28  days after immuni zation with 5  µg BNT16 2b2 (n=8). Actual binding (dark 
blue) and the best fit of the data to a 1:1 binding model (thin line in black)  is shown . 
 
Table  6: Summary of binding kinetic parameters of vaccine -elicited IgG for S1 -His 
Animal  no. kon  
[1/Ms]  koff  
[1/s] KD 
[nM] 
4-1 2.62E+04  9.05E-04 34.5 
4-2 3.36E+04  5.70E-04 17.0 
4-3 2.91E+04  4.92E-04 16.9 
4-4 4.78E+04  5.95E-04 12.5 
4-5 2.94E+04  4.54E-04 15.4 
4-6 2.45E+04  2.95E-04 12.0 
4-7 2.91E+04  3.16E-04 10.9 
4-8 3.36E+04  2.71E-04 8.06 
Geometric 
mean 3.33E+04  4.00E-04 12.0 
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708973
  
 
R&D Report R -20-0085 Version 0 4 Page 39 of 93 
  Strictly Confidential  
Table  7: Summary of binding kinetic parameters of vaccine -elicited IgG for RBD -His 
Animal  no. kon 
[1/Ms]  koff 
[1/s] KD 
[nM] 
4-1 4.35E+05  6.79E-04 1.56 
4-2 2.89E+05  8.04E-04 2.78 
4-3 6.64E+05  7.23E-04 1.09 
4-4 4.82E+05  5.82E-04 1.21 
4-5 4.64E+05  6.26E-04 1.35 
4-6 8.46E+05  4.07E-04 0.481 
4-7 6.36E+05  5.55E-04 0.873 
4-8 1.06E+06  5.42E-04 0.512 
Geometric 
mean 6.02E+05  5.97E-04 0.993 
 
5.3 Pseudovirus -based Neutralization Test  
Virus -neutralizing antibodies in serum s amples obtained on study days  14, 21 , and 28 
were detected by pVNT. Statistical significance was assessed by one -way ANOVA 
with Dunnett’s multiple comparison post -test. 
Treatment with all tested uRNA doses  induced the formation of virus -neutralizing  
antibodies  with temporally increasing pVN 50 titers  (Figure  12). On day 14, several 
samples from animals treated with 0.2  µg modRNA displayed pVN 50 titers  that were 
below the lower limit of quantification. Significantly higher pVN 50 titers  were measured 
in samples from animals treated with the high dose of 5 µg RNA than in buffer control 
samples ( p = 0.0010). On days 21 and 28, the differences of the groups treated with 
1 µg and 5 µg BNT162b2 compared to the buffer control group were statistically 
signific ant (day 21: p = 0.0036 for 1 µg, p < 0.0001 for 5 µg; day 28:  p < 0.0001 for 
1 µg and 5 µg). 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708974
  
 
R&D Report R -20-0085 Version 0 4 Page 40 of 93 
  Strictly Confidential  
 
Figure  12: Titers of ne utralizing antibodies on days  14, 21 , and 28  
Serum samples were collected on days 14, 21 , and 28 after immunizations and titers of virus -neutralizing ant bodies 
were determined by pseudovirus -based neutralization test (pVNT). Individual VNT titers are shown by dots; group 
mean values are indicated by horizontal bars (±SEM, standard error of th e mean). ULOQ: Upper limit of 
quantification, LLOQ: Lower limit of quantification.  ** p ≤ 0.01, *** p ≤ 0.001 , **** p < 0.0001 . 
 
5.4 ELISpot Analysis  
Mice were euthanized on day 28 and splenocytes were isolated to assess T -cell 
responses by ELISpot analysis. S plenocytes were stimulated with S1 - and RBD -
specific overlapping peptide pools (Table  5) and IFN - secretion was detected. 
Statistical significance was assessed by one -way ANOVA with Dunnett’s multiple 
comparison post -test. Control measurements were performed using an irrelevant 
peptide pool, medium only or Concanavalin A (ConA, for exemplary controls for the 
assay performed with frozen splenocytes see Appendix  3: Controls for ELISpot 
Analysis , Figure  21). 
Stimulation of fresh splenocytes with an S protein - or RBD -specific overlapping peptide 
pool induced IFN - responses in T  cells of immunized animals (Figure  13). After 
stimulation with either the S protein -specific or RBD peptide pool , splenocytes of the 
groups treated with modRNA displayed significantly higher spot numbers than buffer 
Buffer 0.2 µg 1 µg 5 µg816326412825651210242048Day 14
BNT162b2 (RBP020.2)pVN50titer [serum dilu ion-1]
LLOQULOQ
Buffer 0.2 µg 1 µg 5 µg816326412825651210242048Day 21
BNT162b2 (RBP020.2)LLOQULOQ
Buffer 0.2 µg 1 µg 5 µg816326412825651210242048Day 28
BNT162b2 (RBP020.2)pVN50titer [serum dilu ion-1]
LLOQULOQ***** ****
**** ****
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708975
  
 
R&D Report R -20-0085 Version 0 4 Page 41 of 93 
  Strictly Confidential  
control splenocytes (for S protein: p = 0.0001 for 0.2  µg, p < 0.0001 for 1 µg; RBD: p = 
0.0094 for 0.2  µg and p < 0.0001 for 1 µg). 
 
 
Figure  13: ELISpot analysis using fresh  splenocytes on day 28  
ELISpot assay was performed using splenocytes isolated on day 28 after immunization. Splenocytes were 
stimulated with S  protein - or RBD -specific overlapping peptide pools and I FN- secretion was measured to assess 
T-cell responses. Individual spot counts are shown by dots; group mean values are indicated by bars (±SEM).  
** p ≤ 0.01, **** p < 0.0001 . Note that for the 5  µg group, a miscalculated ce ll number was used in the assay,  
therefore  this group is  not included in the graph.  
 
In the assay with fresh splenocytes, a miscalculation of cells in the group immunized 
with 5  µg modRNA occurred. Therefore, a second ELISpot run was included with 
frozen splenocytes.  
Stimulation of frozen splenocytes with an S protein - or RBD -specific overlapping 
peptide pool induced IFN - responses in T cells of immunized animals ( Figure  14). 
Frozen splenocytes of the groups treated with modRNA displayed significantly higher 
spot numbers than buffer control splenocytes (p = 0.0087  for 0.2 µg, p  < 0.0001 for 
1 µg and 5 µg) after stimulation with the S protein -specific peptide pool . Stimulation 
with the RBD -specific peptide pool  induced significantly higher spot numbers in the 
groups treated with 1 µg and 5  µg modRNA compared to the buffer control group 
(p = 0.0001 for 1  µg, p = 0.0015 for 5 µg). 
 
Buffer 0.2  µg 1 µg050100150RBD protein peptide mix
BNT162b2 (RBP020.2)
**
****
Buffer 0.2 µg 1 µg050010001500S1 protein peptide mix
BNT162b2 (RBP020.2)IFN-+spots/ 5x105  splenocytes
***
****
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708976
  
 
R&D Report R -20-0085 Version 0 4 Page 42 of 93 
  Strictly Confidential  
 
Figure  14: ELISpot analysis using frozen splenocytes on day 28  
ELISpot assay was performed using previously frozen splenocytes isolated on day 28 after immunization. 
Splenocytes were stimulated with S  protein - or RBD -specific overlapping peptide pools and IFN - secretion was 
measured to assess T -cell responses. Individual spot counts are shown by dots; group mean values are indicated 
by bars (±SEM).  ** p ≤ 0.01, *** p ≤ 0.001 , **** p < 0.0001 . 
 
To identify the responding T -cell subtype , an additional  ELISpot analysi s was 
performed after separation of fresh CD4+ and CD8+ cells by MACS isolation  using 
splenocytes isolated from the group treated with 5  µg RNA.  Statistical significance was 
assessed by one -way ANOVA with Dunnett’s multiple comparison post -test comparing 
cells stimulated with RBD - and S  protein -specific peptide pools to cells stimulated with  
an irrelevant AH -1-specific peptide pool . 
After stimulation with an S  protein -specific peptide pool, but not after stimulation with 
irrelevant AH -1, both CD4+ and CD8+ cells displayed IFN - responses ( Figure  15). The 
differences between cells stimulated with the S  protein -specific peptide pool and the 
cells stimulated  with the AH -1-specific peptide pool were statistically significant 
(p < 0.0001 for CD4+ and CD8+ cells). No significant increase in spot numbers was 
detected in CD4+ and CD8+ cells after stimulation with an RBD -specific peptide pool.  
Buffer 0.2 µg 1 µg 5 µg0100200300400500
S1 protein peptide mix
BNT162b2 (RBP020.2)IFN-+spots/ 1x106  splenocytes
Buffer 0.2  µg 1 µg 5 µg01020304050
RBD protein peptide mix
BNT162b2 (RBP020.2)A B
** **** ******* **
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708977
  
 
R&D Report R -20-0085 Version 0 4 Page 43 of 93 
  Strictly Confidential  
 
Figure  15: ELISpot analysis using splenocytes of 5 µg BNT162b2 (RBP020.2) immunized mice on day 28 
after MACS cell separation  
ELISpot assay was performed using splenocytes isolated on day 28 after immunization from group 4 after magnetic 
cell separation MACS. CD4+ splenocytes (A) or CD8+ splenocytes  (B) were stimulated with an RBD - or S protein -
specific overlapping peptide pool a nd IFN - secretion was measured to assess T -cell responses. ( C) Splenocytes 
were stimulated with an irrelevant peptide or with medium alone or Concanavalin A. IFN - secretion was measured 
to assess T -cell responses. Mean values ±SEM are shown.  **** p < 0.0001. 
 
5.5 Luminex Assay  
Cytokine concentrations in supernatants of re -stimulated splenocytes were determined 
using a bead -based, 11 -plex TH1/T H2 mouse ProcartaPlex immunoassay  (Table  8). 
Table  8: Chemokines and cytokines included for multiplex measurement  
T-cell population  Analyte s 
TH1 IFN-, GM -CSF, TNF -, IL-1, IL-6, IL-12p70, IL -18 
TH2 IL-4, IL-5, IL-13 
Teff IL-2 
 
For cytokine analysis, frozen splenocytes from immunized animals were stimulated 
with eit her medium, PMA and ionomycin,  or the S- or RBD -overlapping peptide mix.  
Immunization with BNT162b2 induced an increased level of T H1-specific  and 
proinflammatory  analytes. Stimulation of splenocytes with 0. 1 µg/mL per peptide (total 
peptide concentration = 31.5 µg/mL) of the S -specific overlapping  peptide pool induced 
a stronger increase in cytokine concentrations than 0.66 µg/mL per peptide (total 
peptide concent ration = 31.5 µg/mL) of the RBD -specific overlapping peptide pool . 
Several values were below the lower level of quantification . Therefore, statistical 
analysis was assessed by mixed -effects analysis/Sidak’s comparison.  Taking the 
background of the buffer group, medium control signal into account, a stimulation of 
AH1 RBD S0200400600
CD4+ splenocytesIFN-+spots/
5x105 CD4+ cells (flow trough)
AH1 RBD S0200400600
CD8+ splenocytesIFN-+spots/ 1x105  CD8+cells
CD4+ Medium CD8+ MediumCD4+ ConA CD8+ ConA05001000150020002500
ControlsIFN-+spots/ 5x105  splenocytesA B C
********
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708978
  
 
R&D Report R -20-0085 Version 0 4 Page 44 of 93 
  Strictly Confidential  
IFN-, TNF -, GM -CSF, IL-6, IL-18, and IL -2 was observed for the groups immunized 
with 1  µg BNT162b2 (Figure  16). Due to the missing values, statistical significance was 
not reached or could in some cases not be calculated for the cytokines shown in  
Figure  16 , even though a clear trend was observed. Therefore, statistical significance 
is not depicted, but only shown in  Appendix  6: Statistical Analysis . 
A more detailed summary of the results including PMA controls is shown in Appendix  4: 
Summary of Luminex Assay. 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708979
  
 
R&D Report R -20-0085 Version 0 4 Page 45 of 93 
  Strictly Confidential  
 
Figure  16: Cytokine concentrations in supernatants of re -stimulated splenocytes  28 days after 
immunization  
Luminex assay was performed using frozen splenocytes isolated on day  28 after RNA injection to  assess 
concentrations of the indicated chemokines/cytokines. After 48  h of stimulation with S- or RBD -overlapping peptide 
mix, supernatant was collected  and secretion  of different A) T H1-specific and proinflammatory, B) T eff-specific and 
Buffer 0.2 µg 1 µg 5 µg0510152025
IL-4[pg/mL]
BNT162b2 (RBP020.2)
<LLOQ<LLOQ<LLOQ
<LLOQ
<LLOQ
<LLOQ
<LLOQ
<LLOQ
<LLOQ
Buffer 0.2 µg 1 µg 5 µg050100150200IL-13
BNT162b2 (RBP020.2)
<LLOQ<LLOQ
<LLOQ
<LLOQ
<LLOQ
<LLOQ
<LLOQC
Buffer 0.2 µg 1 µg 5 µg0100200300400500
IL-5
BNT162b2 (RBP020.2)
<LLOQ<LLOQ<LLOQ
<LLOQ
<LLOQ
<LLOQ
<LLOQ
<LLOQ
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708980
  
 
R&D Report R -20-0085 Version 0 4 Page 46 of 93 
  Strictly Confidential  
C) T H2 cytokines  was determined . Values for individual animals are  shown by dots. Although all animals within the 
groups were tested, several values were excluded as they were below the lower level of quantification (LLOQ) and 
out of standard range. If all values within on e group were <LLOQ, this is marked in the graph. Mean values ±SEM 
are shown.  
5.6 Intracellular Cytokine Staining  
ICS was performed after stimulation of splenocytes with an overlapping peptide pool 
of the S  protein  or controls  (Figure  17). Statistical significance was assessed by one -
way ANOVA with Dunnett’  multiple compari on po t te t 
Due to  a miscalculation of cells in the group immunized with 5 µg modRNA, ICS results 
are only shown for buffer control and the groups treated with 0.2  µg and 1  µg 
BNT162b2.  
A peptide -specific stimulation was observed for specific cytokines. The fraction of IFN -
-expressing CD4+ T cells was significantly higher for animals immunized with 0.2  µg 
and 1  µg BNT162c2 (p  = 0.0002 for 0.2  µg, p  < 0.000 1 for 1 µg, Figure  17A) than for 
buffer control animals. No statistically significant increase was observed for IL -4 after 
BNT162c2 treatment in comparison to buffer control (Figure  17B). The fraction of TNF -
-expressing CD4+ T cells was significantly higher for animals immunized with 1  µg 
modRNA (p  < 0.0001,  Figure  17C) than for animals treated with buffer control.  For IL -
2 expression, the CD4+ T-cell fractions were significantly higher in both treatment 
groups than in the buffer control group ( p = 0.0015 for 0.2  µg, p  = 0.0001 for 1  µg, 
Figure  17D). 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708981
  
 
R&D Report R -20-0085 Version 0 4 Page 47 of 93 
  Strictly Confidential  
 
Figure  17: CD4+ T cell intracellular cytokine staining 28 days after immunization  
On day  28 after RNA injection, isolated splenocytes were stimulated with either buffer, PMA or a n S protein -
overlapping peptide mix (Pepmix) to assess the detailed T -cell response via flow cytometry. The intracellular 
cytokine expression of CD4+ T cells expressing  (A) IFN -, (B) IL -4, (C) TNF -, or (D) IL -2 was analyzed. The left 
Buffer 0.2 µg 1 µg0.000.050.100.150.200.25
BNT162b2 (RBP020.2)% CD3+CD4+IFN+of single live cells
***
****
Medium PMA Pepmix S02468
Buffer 0.2 µg 1 µg0.060.080.100.120.14
BNT162b2 (RBP020.2)% CD3+CD4+IL4+of single live cells
Medium PMA Pepmix S0.00.20.40.60.81.0
Buffer 0.2 µg 1 µg0.00.10.20.3
BNT162b2 (RBP020.2)% CD3+CD4+TNF+of single live cells
****
Medium PMA Pepmix 020406080100
Buffer 0.2 µg 1 µg0.00.10.20.3
BNT162b2 (RBP020.2)% CD3+CD4+IL2+of single live cells
**
***
Medium PMA Pepmix 0204060TH1 cells
TH2 cellsA
CB
D
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708982
  
 
R&D Report R -20-0085 Version 0 4 Page 48 of 93 
  Strictly Confidential  
graph in each subfigure shows  the fraction after peptide stimulation (measured in duplicates), the right graph shows  
each single value for all stimulation conditions (buffer and PMA stimulation was measured in single replicates, th e 
Pepmix is t he same data as in the left graph  but with  all single values). Mean values ±SEM are shown.  ** p ≤ 0.01; 
*** p ≤ 0.001 ; **** p ≤ 0.0001. 
 
For CD8+ T cells, a statistically significant induction of IFN -, TNF -, and IL -2 was 
detectable after pep tide stimulation in the groups im munized with  0.2 µg and 1  µg RNA 
compared to buffer control (IFN -: p = 0.0002 for 0.2  µg, p  < 0.0001 for 1  µg; TNF -: 
p = 0.0013 for 0.2  µg, p  < 0.0001 for 1  µg; IL -2: p = 0.0003 for 0.2  µg, p < 0.0001 for 
1 µg; Figure  18A, B, and C).  
 
Figure  18: CD8+ T cell intracellular cytokine staining 28 days after immunization  
On day  28 after RNA injection, isolated splenocytes were stimulated with either buffer, PMA or a n S protein -
overlapping peptide mix (Pepmix) to assess the detailed T -cell response via flow cytometry. The intracellular 
Buffer 0.2 µg 1 µg0.00.20.40.60.81.0
BNT162b2 (RBP020.2)% CD3+CD8+IFN+of single live cells
***
****
Medium PMA Pepmix 01020304050
Buffer 0.2 µg 1 µg0.00.51.0
BNT162b2 (RBP020.2)% CD3+CD8+TNF+of single live cells
**
****
Medium PMA Pepmix 020406080
Buffer 0.2 µg 1 µg0.00.20.4
BNT162b2 (RBP020.2)% CD3+CD8+IL2+of single live cells
***
****
Medium PMA Pepmix 0510152025A
CB
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708983
  
 
R&D Report R -20-0085 Version 0 4 Page 49 of 93 
  Strictly Confidential  
cytokine expression of CD8+ T cells expressing (A) IFN -, (B) TNF -, or (C) IL -2 was analyzed. The left graph in 
each subfigure shows  the fraction after peptide stimulation (measured in duplicates), the right graph shows  each 
single value for all stimulation conditions (buffer and PMA stimulation was meas ured in single replicates, the P epmix 
is the same data as in the left gra ph but wi th all single values). Mean values ±SEM are shown.  ** p ≤ 0.01; 
*** p ≤ 0.001; ****  p ≤ 0.0001.  
 
5.7 Animal Monitoring  
The animals’ body weight as well as observations regarding fur appearance and 
injection site reactions are shown in  Figure  19 and Figure  20. 
The group mean body weights of animals treated with RNA displayed a development 
comparable to the buffer control group (Figure  19). Over the course of the study, a 
slight increase in body weights was observed for all groups.  
 
Figure  19: Body weights of experimental mice  during study  
Experimental animals were weighed at study start and at indicated days , and the change in body weight was 
calculated as a percentage of the initial weight of the individual mouse . Group mean values (±SEM) are shown . 
 
No changes in fur appearance (i.e., fur  defects, neglected grooming, ruffled) were 
observed in animals treated with BNT162 b2 (Figure  20A). 
Slight to distinct observations at the injected muscle (i.e., edema formation seen as 
swollen muscle without flinching in reaction to touch, indicating absence of pain) in 
comparison to the non -injected hind leg were made in animals treated with 1 µg and 
5 µg of BNT162 b2 (Figure  20B). By day 2 (1 µg group) or latest by day 4 (5 µg group), 
the injection site reactions had fully resolved.  
0 5 10 15 20 25 308090100110120
Days post application% of initial body weightBuffer
0.2 µg BNT162b2 (RBP020.1)
1 µg BNT162b2 (RBP020.1)
5 µg BNT162b2 (RBP020.1)
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708984
  
 
R&D Report R -20-0085 Version 0 4 Page 50 of 93 
  Strictly Confidential  
Additional animal m onitoring details are shown in  Appendix  1: Animal Monitoring - 
Observations . 
 
Figure  20: Summary of observations made during study’s concomitant animal monitoring  
Shown are deviations to normal appearance in (A) fur condition and (B) observations at the injection site (edema 
formation) of each mouse . Severity of observations is graded with 0, none; +, slight; ++, moderate ; and + ++, distinct.  
  
A B
1 2 3 4
BIO-LJ26 0 0 0 0
BIO-LJ27 0 0 0 0
BIO-LJ28 0 0 0 0
BIO-LJ29 0 0 0 0
BIO-LJ30 0 0 0 0
BIO-LJ31 0 0 0 0
BIO-LJ32 0 0 0 0
BIO-LJ33 0 0 0 0
BIO-LJ34 0 0 0 0
BIO-LJ35 0 0 0 0
BIO-LJ36 0 0 0 0
BIO-LJ37 0 0 0 0
BIO-LJ38 0 0 0 0
BIO-LJ39 0 0 0 0
BIO-LJ40 0 0 0 0
BIO-LJ41 0 0 0 0
BIO-LJ42 0 0 0 0
BIO-LJ43 + 0 0 0
BIO-LJ44 + 0 0 0
BIO-LJ45 + 0 0 0
BIO-LJ46 + 0 0 0
BIO-LJ47 + 0 0 0
BIO-LJ48 + 0 0 0
BIO-LJ49 + 0 0 0
BIO-LJ50 +++ ++ + 0
BIO-LJ51 ++ ++ + 0
BIO-LJ52 ++ ++ + 0
BIO-LJ53 ++ + 0 0
BIO-LJ54 ++ ++ + 0
BIO-LJ55 +++ ++ + 0
BIO-LJ56 ++ + 0 0
BIO-LJ57 ++ + 0 0Days post applicationTreatment Mouse ID
0.2 µg 
BNT162b2
(RBP020.2)
1 µg    
BNT162b2
(RBP020.2)
5 µg    
BNT162b2
(RBP020.2)Buffer
dpi
1
BIO-LJ26 0
BIO-LJ27 0
BIO-LJ28 0
BIO-LJ29 0
BIO-LJ30 0
BIO-LJ31 0
BIO-LJ32 0
BIO-LJ33 0
BIO-LJ34 0
BIO-LJ35 0
BIO-LJ36 0
BIO-LJ37 0
BIO-LJ38 0
BIO-LJ39 0
BIO-LJ40 0
BIO-LJ41 0
BIO-LJ42 0
BIO-LJ43 0
BIO-LJ44 0
BIO-LJ45 0
BIO-LJ46 0
BIO-LJ47 0
BIO-LJ48 0
BIO-LJ49 0
BIO-LJ50 0
BIO-LJ51 0
BIO-LJ52 0
BIO-LJ53 0
BIO-LJ54 0
BIO-LJ55 0
BIO-LJ56 0
BIO-LJ57 0Treatment Mouse ID
0.2 µg
BNT162b2
(RBP020.2)
1 µg
BNT162b2
(RBP020.2)
5 µg
BNT162b2
(RBP020.2)Buffer
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708985
  
 
R&D Report R -20-0085 Version 0 4 Page 51 of 93 
  Strictly Confidential  
6 CONCLUSION  
Treatment with all tested BNT162b2 doses, namely 0.2, 1 and 5  µg, induced a strong 
immune response across the observation period of 28 days after vaccination with a 
safe profile in terms of animal monitoring.  
Total IgG ELISA show ed that the construct is immunogenic and induced a strong, 
dose -dependent generation of antibodies against the S1 antigen and the receptor -
binding domain. First detection of IgG antibodies was possible 7 days after 
immunization for all animals throughout t he groups with an increase of total antibody 
amount until day 2 8. At day 28 after immuni zation, vaccine -elicited IgG had a strong 
binding affinity for S1 (geometric mean K D = 12 nM) and the RBD (geometric mean 
KD = 0.99 nM), both had low off -rates. 
Profiling the IgG subtypes, a balanced IgG2a/ IgG1 response was detected  for the two 
higher doses, while the low dose induced a response with higher IgG1 than IgG2 
levels . In pVNT analysis, starting  14 days after immunization, a development of  
functional ne utralizing antibodies  was shown for all animals  and the titers increased 
until the final study day. The summary of antibody titers at day 28 is as follows:  
 BNT162b2  
0.2 µg BNT162b2  
1 µg BNT162b2  
5 µg 
Anti-S1 protein total IgG [µg/mL]  73.0 ± 10.4 205.9 ± 21.0 392.7 ± 28.9  
Anti-RBD protein total IgG [µg/mL]  83.1 ± 12.3  241.7 ± 17.2  448.6 ± 28.6  
pVN 50 titer [reciprocal dilution]  33.0 ± 9.8  192.0 ± 31.4  312.0 ±35.1  
 
The ELISpot assay confirmed a strong T -cell activation with the dose of 1  µg resulting 
in the strongest reactivity. An additional ELISpot with CD8+- and CD4+-separated 
T cells showed both a reactive CD8+ and CD4+ T-cell response . In Luminex analysis, 
chemokines and cytokine production after peptide stimulation was confirmed for the 
group dosed with 1 µg for analytes that indicate a T H1-driven and proinflammatory 
immune response  in line with the ELISpot . Similarly, reactive IFN --, TNF--, and IL -
2-secreting CD4+ as well as CD8+ T cells were detected after peptide stimulation in 
ICS. Taken together, the cellular analysis revealed that in addition  to a cytotoxic CD8+ 
T-cell response, a T H1-specific response was activated after peptide stimulation.  
In summary, the vaccine c andidate was highly immunogenic and  induced high IgG and 
neutralizing antibody  titers against the antigen as well as  a desired T H1-driven T -cell 
response including a strong cytotoxic T -cell response. Therefore, BNT162b2 is a 
promising candidate for further testing in clinical trial.  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708986
  
 
R&D Report R -20-0085 Version 0 4 Page 52 of 93 
  Strictly Confidential  
7 DOCUMENT HISTORY  
Reason s for change s compared to previous version:  
Minor editorial changes, such as the correction of typing errors, are not specifically 
listed.  
Section s Version 01  Version 02  Reason for change  
1 - Further 
experimental 
information 
added  Added SPR measurements of binding affinities of 
BNT162b2 vaccine -induced SARS -CoV-2-specific 
antibodies toward  recombinant SARS -CoV-2 S 
and RBD  proteins.  2.4 
3.3 
4.5.6  
5.2 
6 
4.4 - Further 
equipment and 
software 
information 
added  Equipment table was added and software table 
was updated.  
 
Sections  Version 02  Version 03  Reason for change  
List of 
Abbreviation s - Update of list  Additional abbreviation s included . 
2.4 - Further 
experimental 
information 
added  Reciprocal endpoint serum titer added for day 14 
and day 28 serum samples . 4.5.5  
5.1.1  
4.5.10  - Luminex  The used peptide concentration was corrected 
and the CoA of the ProcartaPlex was included . 5.5 
9 
4.5.11  - ICS The used peptide concentration was corrected . 
5.2 - SPR Table corrected . 
 
Sections  Version 0 3 Version 0 4 Reason for change  
4.5.3.1  - Information for 
3 doses of 
BNT162b2 
modified  Doses corrected  
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708987
  
 
R&D Report R -20-0085 Version 0 4 Page 53 of 93 
  Strictly Confidential  
8 REFERENCES  
Fukushi S, Mizutani T, Saijo M, Matsuyama S, Miyajima N, Taguchi F et al. Vesicular 
Stomatitis Virus Pseudotyped with severe acute respiratory syndrome coronavirus 
spike protein.  J Gen Virol. 2005;86(Pt 8):2269 -2274.  
Hoffmann M, Kleine -Weber H, Schroeder S, Krüger N, Herrler T, Erichsen S  et al. 
SARS -CoV-2 Cell Entry Depends o n ACE2 and TMPRSS2 and Is Blocked by a 
Clinically Proven Protease Inhibitor  Cell. 2020;181(2):271 -280. 
Kirchdoerfer RN, Wang N, Pallesen J, Wrapp D, Turner HL, Cottrell CA et al. Stabilized 
coronavirus spikes are resistant to conformational changes induced  by receptor 
recognition or proteolysis. Sci Rep. 2018;8(1):15701.  
Lawson ND, Stillman EA, Whitt MA, Rose JK. Recombinant vesicular stomatitis viruses 
from DNA. Proc Natl Acad Sci U S A. 1995;92(10):4477 -81. 
Moyo N, Vogel AB, Buus S, Erbar S, Wee EG, Sahin  U et al. Efficient Induction of 
T Cells against Conserved HIV -1 Regions by Mosaic Vaccines Delivered as Self -
Amplifying mRNA. Molecular therapy. Methods & clinical development. 2018;12, 
32-46. 
Pallesen J, Wang N, Corbett KS, Wrapp D, Kirchdoerfer  RN, Turner HL  et al. 
Immunogenicity and structures of a rationally designed prefusion MERS -CoV spike 
antigen. Proc Natl Acad Sci USA. 2017;114(35):E7348 -E7357.  
Pardi N, Hogan MJ, Pelc RS, Muramasu H, Andersen H, DeMaso CR et  al. Zika virus 
protection by a  single low -dose nucleoside -modified mRNA vaccinatio n. Nature. 
2017;543 (7644), 248 -251. 
Ullman -Culleré MH, Foltz CJ. Body condition scoring: a rapid and accurate method for 
assessing health status in mice. Lab Anim Sci. 1999;49(3):319 -23. 
Vogel AB, Lamber t L, Kinnear E, Busse D, Erbar S, Reuter KC et  al. Self-amplifying 
RNA vaccines give equivalent protection against influenza to mRNA vaccines but at 
much lower doses. Molecular therapy: the journal of the American Society of  Gene 
Therapy. 2017;26 (2), 446 -455. 
Wrapp D, Wang N, Corbett KS, Goldsmith JA, Hsieh CL, Abiona O  et al. Cryo -EM 
structure of the 2019 -nCoV spike in the prefusion conformation. Science. 
2020;367(6483):1260 -1263. 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708988
  
 
R&D Report R -20-0085 Version 0 4 Page 54 of 93 
  Strictly Confidential  
9 APPENDIX  
Appendix  1: Animal Monitoring - Observations  
 
Table  9: Parameters for experimental animal monitoring (single mouse  assessment)  
The table is separated in immediate euthanasia  criteria  (end of experiment ) and criteria which solitarily observed do not lead to an imme diate termination , but result in  shorter 
monitoring frequency (re -assessment).  
  Observation (if applicable , categorize a): 
Code  Parameter  Renew assessment within <  24 h. Attention: 
evaluate cumulation  Immediate euthanasia  criteria  
1 Bodyweight b. Take into account 
Body Conditioning Score (BCS) c Body weight loss > 5 – 10% or BCS transition 3  
2 Bodyweight loss > 15 - 20% or BCS 2  
2 Activity  Moderate deviation from normal or u nusual 
behavior (e.g. , limited,  reduced , or hyperactive 
movements)  Immobility, very slow movements (high grade of 
lethargy), self -isolation  
3 Appearance (condition) of fur & 
eyes  Fur defects/ grooming malfunction (reduced or 
exaggerated grooming). Moderate orbital 
tightening.  Distinct scruffy fur, strongly neglected grooming. Eyes 
lids narrowed, eyes closed and sticky.  
4 Body cavities & body fluids  slight - moderate damp & sticky cavities  Clinical signs of disease (diarrhea, distinct sticky)  
5 Body temperature & blood 
circulation ears  - Animal ’s body temperatu re low, ears appear white , and  
hardly noticeable blood vessels  
6 Posture  Moderate deviation of normal physi ological 
posture  i.e., short pause in hunched posture  Abnormal posture, hunched, abnormal ly stretched (belly 
touches ground) or cramps  
7 Reaction to stimulus  d Delayed reaction  to unconditioned stimulus, 
moderate deviation from normal behavior (e.g. , 
slight - moderate apathy)  Abnorm al (distinct delayed reaction to unconditioned 
stimulus). Winding and enduring sound utterance (“pain” ),  
aggressiveness at touch  
8 Automutilation   - Burden for the animal noticeable i.e. , missing extremities, 
continuous nibbling, biting and gnawing, open wounds  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708989
  
 
R&D Report R -20-0085 Version 0 4 Page 55 of 93 
  Strictly Confidential  
  Observation (if applicable , categorize a): 
Code  Parameter  Renew assessment within <  24 h. Attention: 
evaluate cumulation  Immediate euthanasia  criteria  
9 Bites (tail,  vibrissae, reproductive 
organs ), other wounds  Open and bleeding wounds (take care of wounds 
and separate animal)  Burden for the animal noticeable i.e. , inflamed wounds  
10 Respiration frequency  Moderate deviation of spontaneous breathing 
(normal respiration frequency)  High frequency, any sign of dyspnea, gasping, flat 
stretched posture in combination  with strongly retracting 
flanks  
11 Motor function  Weak, loose grip (cage grid)  Staggering, circular movement, missing grasp  
12 Other abnormalities e  -  - 
a Categories: NAD , no abnormality detected ; +, slight ; ++, moderate ; +++, distinct.  
b Calculate ratio bodyweight start of experiment/ bodyweight monitoring day . 
c According to  Ullman -Culleré and Foltz 1999 . 
d Unconditioned = Stimulus to force a reaction e.g. , normal background noise, tapping the cage , and  normal handling procedure e.g. , tilt and turns of the cage . 
e Description of abnormality (or abnormalities) on monitoring sheet . 
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708990
  
 
R&D Report R -20-0085 Version 0 4 Page 56 of 93 
  Strictly Confidential  
Table  10: Record of  body weight s of experimental mice  during study  
 
Cage Mouse ID Strain Gender Date of birth Treatment Day 0 Day 1 Day 2 Day 3 Day 4 Day 7 Day 14 Day 21 Day 28
SBIO-15164 BIO-LJ26 BALB/cJRj f 28.01 20 1 21.4 21.6 21.6 22 0 21.9 21.7 22.1 22.2 24.4
SBIO-15164 BIO-LJ27 BALB/cJRj f 28.01 20 1 22.0 22.4 21.6 22 2 23.9 22.2 23.1 22.9 24.2
SBIO-15164 BIO-LJ28 BALB/cJRj f 28.01 20 1 19.9 20.8 20.7 21.1 20.7 20.3 21.3 20.9 22.7
SBIO-15164 BIO-LJ29 BALB/cJRj f 28.01 20 1 22.3 22.8 23.1 23.4 22.3 22.7 23.2 24.4 24.2
SBIO-15165 BIO-LJ30 BALB/cJRj f 28.01 20 1 21.6 21.2 20.9 21 5 21.4 21.2 23.4 22.4 23.9
SBIO-15165 BIO-LJ31 BALB/cJRj f 28.01 20 1 20.8 20.8 20.8 21 2 21.2 21.7 21.9 23.4 24.0
SBIO-15165 BIO-LJ32 BALB/cJRj f 28.01 20 1 21.8 22.1 22.2 22 8 22.1 22.6 22.8 23.4 24.2
SBIO-15165 BIO-LJ33 BALB/cJRj f 28.01 20 1 22.1 22.1 21.9 22 5 22.5 22.5 22.7 22.8 23.8
SBIO-15166 BIO-LJ34 BALB/cJRj f 28.01 20 2 20.1 20.6 19.9 20 3 20.0 20.6 20.5 21.6 21.8
SBIO-15166 BIO-LJ35 BALB/cJRj f 28.01 20 2 20.6 20.6 19.8 19.7 20.1 20.1 20.3 20.7 21.8
SBIO-15166 BIO-LJ36 BALB/cJRj f 28.01 20 2 19.7 20.7 20.3 20 5 20.0 20.3 20.1 20.7 21.3
SBIO-15166 BIO-LJ37 BALB/cJRj f 28.01 20 2 20.3 20.2 20.2 20 5 20.7 21.9 21.0 22.5 22.8
SBIO-15167 BIO-LJ38 BALB/cJRj f 28.01 20 2 21.2 21.7 21.6 22.7 21.8 21.6 21.9 23.3 24.1
SBIO-15167 BIO-LJ39 BALB/cJRj f 28.01 20 2 21.2 21.7 21.3 22.1 22.3 21.7 21.8 23.1 23.5
SBIO-15167 BIO-LJ40 BALB/cJRj f 28.01 20 2 19.6 20.8 20.9 20 8 20.7 20.6 20.6 21.4 22.6
SBIO-15167 BIO-LJ41 BALB/cJRj f 28.01 20 2 21.0 21.5 21.4 22.1 22.1 21.9 21.0 22.2 22.9
SBIO-15168 BIO-LJ42 BALB/cJRj f 28.01 20 3 19.7 19.7 19.7 19 5 19.6 19.6 19.9 21.1 20.8
SBIO-15168 BIO-LJ43 BALB/cJRj f 28.01 20 3 21.2 22.5 22.0 22 6 23.1 22.2 22.7 23.3 23.5
SBIO-15168 BIO-LJ44 BALB/cJRj f 28.01 20 3 21.7 21.5 21.8 22 5 22.4 20.9 23.6 21.9 24.4
SBIO-15168 BIO-LJ45 BALB/cJRj f 28.01 20 3 20.8 21.1 21.1 21 8 21.4 21.6 22.6 23.5 23.5
SBIO-15169 BIO-LJ46 BALB/cJRj f 28.01 20 3 20.5 20.6 21.0 20 8 20.7 20.9 21.4 22.0 22.6
SBIO-15169 BIO-LJ47 BALB/cJRj f 28.01 20 3 20.2 20.4 20.5 21 6 20.6 20.5 20.7 21.2 22.8
SBIO-15169 BIO-LJ48 BALB/cJRj f 28.01 20 3 19.8 20.9 20.9 21 5 20.1 20.7 21.9 20.9 23.3
SBIO-15169 BIO-LJ49 BALB/cJRj f 28.01 20 3 20.5 20.7 21.2 21 2 21.1 20.9 21.0 21.4 22.2
SBIO-15170 BIO-LJ50 BALB/cJRj f 28.01 20 4 22.6 22.1 22.9 23 6 23.6 22.7 23.2 24.5 24.9
SBIO-15170 BIO-LJ51 BALB/cJRj f 28.01 20 4 22.4 21.5 21.5 22.1 22.3 22.1 23.0 22.8 23.9
SBIO-15170 BIO-LJ52 BALB/cJRj f 28.01 20 4 21.2 20.9 20.3 20 8 21.2 21.6 21.0 21.7 23.2
SBIO-15170 BIO-LJ53 BALB/cJRj f 28.01 20 4 21.8 20.5 21.2 21 8 22.1 22.1 22.0 22.9 25.1
SBIO-15171 BIO-LJ54 BALB/cJRj f 28.01 20 4 20.3 19.7 19.5 20 2 20.1 20.0 20.5 20.8 22
SBIO-15171 BIO-LJ55 BALB/cJRj f 28.01 20 4 20.5 19.2 19.1 22 9 20 20.8 20.4 20.2 22
SBIO-15171 BIO-LJ56 BALB/cJRj f 28.01 20 4 22 20.8 21.2 21 8 22.2 22.3 22.1 22.9 23.4
SBIO-15171 BIO-LJ57 BALB/cJRj f 28.01 20 4 22.8 21.3 21.3 22 9 22.5 21.8 22.6 24.4 24Bodyweight (grams)
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708991
  
 
R&D Report R -20-0085 Version 0 4 Page 57 of 93 
  Strictly Confidential  
Table  11: Record of animal monitoring for each mouse during study  
 
Cage Mouse ID Strain Gender Date of birth Treatment Day 0 Day 1 Day 2 Day 3 Day 4 Day 7 Day 14 Day 21 Day 28
SBIO-15164 BIO-LJ26 BALB/cJRj f 28.01.20 1 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15164 BIO-LJ27 BALB/cJRj f 28.01.20 1 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15164 BIO-LJ28 BALB/cJRj f 28.01.20 1 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15164 BIO-LJ29 BALB/cJRj f 28.01.20 1 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15165 BIO-LJ30 BALB/cJRj f 28.01.20 1 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15165 BIO-LJ31 BALB/cJRj f 28.01.20 1 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15165 BIO-LJ32 BALB/cJRj f 28.01.20 1 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15165 BIO-LJ33 BALB/cJRj f 28.01.20 1 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15166 BIO-LJ34 BALB/cJRj f 28.01.20 2 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15166 BIO-LJ35 BALB/cJRj f 28.01.20 2 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15166 BIO-LJ36 BALB/cJRj f 28.01.20 2 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15166 BIO-LJ37 BALB/cJRj f 28.01.20 2 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15167 BIO-LJ38 BALB/cJRj f 28.01.20 2 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15167 BIO-LJ39 BALB/cJRj f 28.01.20 2 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15167 BIO-LJ40 BALB/cJRj f 28.01.20 2 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15167 BIO-LJ41 BALB/cJRj f 28.01.20 2 NAD NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15168 BIO-LJ42 BALB/cJRj f 28.01.20 3 NAD 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15168 BIO-LJ43 BALB/cJRj f 28.01.20 3 NAD 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15168 BIO-LJ44 BALB/cJRj f 28.01.20 3 NAD 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15168 BIO-LJ45 BALB/cJRj f 28.01.20 3 NAD 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15169 BIO-LJ46 BALB/cJRj f 28.01.20 3 NAD 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15169 BIO-LJ47 BALB/cJRj f 28.01.20 3 NAD 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15169 BIO-LJ48 BALB/cJRj f 28.01.20 3 NAD 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15169 BIO-LJ49 BALB/cJRj f 28.01.20 3 NAD 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15170 BIO-LJ50 BALB/cJRj f 28.01.20 4 NAD 12+++ 12++ 12+ NAD NAD NAD NAD NAD
SBIO-15170 BIO-LJ51 BALB/cJRj f 28.01.20 4 NAD 12++ 12++ 12+ NAD NAD NAD NAD NAD
SBIO-15170 BIO-LJ52 BALB/cJRj f 28.01.20 4 NAD 12++ 12++ 12+ NAD NAD NAD NAD NAD
SBIO-15170 BIO-LJ53 BALB/cJRj f 28.01.20 4 NAD 12++ 12+ ok NAD NAD NAD NAD NAD
SBIO-15171 BIO-LJ54 BALB/cJRj f 28.01.20 4 NAD 12++ 12++ 12+ NAD NAD NAD NAD NAD
SBIO-15171 BIO-LJ55 BALB/cJRj f 28.01.20 4 NAD 12+++ 12++ 12+ NAD NAD NAD NAD NAD
SBIO-15171 BIO-LJ56 BALB/cJRj f 28.01.20 4 NAD 12++ 12+ NAD NAD NAD NAD NAD NAD
SBIO-15171 BIO-LJ57 BALB/cJRj f 28.01.20 4 NAD 12++ 12+ NAD NAD NAD NAD NAD NADAnimal Monitoring - Observations
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708992
  
 
R&D Report R -20-0085 Version 0 4 Page 58 of 93 
  Strictly Confidential  
Appendix  2: Certificates of Analysis  
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
(b) (4)
(b) (6)
(b) (6)
FDA-CBER-2021-5683-0708993
  
 
R&D Report R -20-0085 Version 0 4 Page 59 of 93 
  Strictly Confidential  
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
(b) (4)
(b) (6)
FDA-CBER-2021-5683-0708994
  
 
R&D Report R -20-0085 Version 0 4 Page 60 of 93 
  Strictly Confidential  
 
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708995
  
 
R&D Report R -20-0085 Version 0 4 Page 61 of 93 
  Strictly Confidential  
   
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
(b) (6)
FDA-CBER-2021-5683-0708996
  
 
R&D Report R -20-0085 Version 0 4 Page 62 of 93 
  Strictly Confidential  
Appendix  3: Controls for ELISpot Analysis  
 
Figure  21: Controls for ELISpot analysis using splenocytes on day  28 
ELISpot assay was performed using splenocytes isolated on day  28 after immunization. Splenocytes were 
stimulated with the irrelevant peptide AH-1 (left), or with Concanavalin A or medium alone (right). IFN - secretion 
was measured to assess T -cell responses. Mean values ±SEM are shown.  
Buffer 0.2 µg 1 µg 5 µg01020304050
AH-1
BNT162b2 (RBP020.2)IFN-+spots/ 1x106  splenocytes
ConA
Medium 0500100015002000 Controls
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708997
  
 
R&D Report R -20-0085 Version 0 4 Page 63 of 93 
  Strictly Confidential  
Appendix  4: Summary of Luminex Assay Data  
 
Figure  22: TH1 and proinflammatory c ytokine concentrations in supernatants of re -stimulated splenocytes 
28 days after immunization  
Luminex assay was performed using frozen mouse splenocytes isolated on day  28 after RNA injection to assess 
concentrations of the indicated chemokines/cytokines. After 48  h of stimulation with medium, PMA plus ionomycin 
(PMA) , or the S -/RBD -overlapping pep tide mix, supernatant was used for the analysis of  the secretion of different 
analytes. Values for i ndividual animals are  shown by dots; group mean values are indicated by lines (±SEM). 
Several values were excluded, as they were below the LLOD  or out of the standard range (<LLOQ) or upper the 
limit of quantification (ULOQ). Therefore, no statistical information was included in the figure (for calculation , see 
Appendix  6: Statistical Analysis ). Medium , S 0. 1 µg/mL  and RBD 0.66 µg/mL per  peptide are shown in  Figure  16. 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708998
  
 
R&D Report R -20-0085 Version 0 4 Page 64 of 93 
  Strictly Confidential  
 
Figure  23: TH2 cytokine and IL -2 concentrations in supernatants of re -stimulated splenocytes 28  days after 
immunization  
Luminex assay was performed using frozen mouse splenocytes isolated on day 28 after RNA injection to assess 
concentrations of the indicated chemokines/cytokines. After 48  h of stimulation with medium, PMA plus ionomycin 
(PMA) , or the S -/RBD -overlapping peptide mix, supernatant was used for the analysis of  the secretion of different 
analytes. Values for i ndividual animals are  shown by dots; group mean values are indicated by lines (±SEM). The 
RBD peptide mix was not tested for animals treated with 0.2  µg and 1  µg RNA. Several values were excluded , as 
they were below the LLOD  or out of the standard range (<LLOQ). Therefore, no statistical information was included 
in the figure (for calculation , see Appendix  6: Statistical Analysis ). Medium , S 0. 1 µg/mL  and RBD 0.66 µg/mL per  
peptide are shown in  Figure  16. Note after PMA stimulation, all IL -2 concentration s were above the upper limit of 
quantification (ULOQ).  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0708999
  
 
R&D Report R -20-0085 Version 0 4 Page 65 of 93 
  Strictly Confidential  
Appendix  5: Detailed ICS Protocol  
 
FACS panel (FACS Celesta)  
 Wavelengths  Markers  µL per 
50 µL Clones  Colors  Name  Company  Catalog  
no. 
1 450/50  CD8a  0.25 53-6.7 BV421  Brilliant Violet 
421™ anti -
mouse CD8a 
antibody  BioLegend  100753  
2 525/50  CD4 0.25 RM4 -5 BV510  Brilliant Violet 510™ 
anti-mouse CD4 
antibody  BioLegend  100559  
 610/20   no  BV605     
3 710/50  IL-4 0.25 11B11  BV711  Brilliant Violet 
711™ anti -
mouse IL -4 
antibody  BioLegend  504133  
4 780/60  CD25  0.25 PC61  BV786  Brilliant Violet 
785™ anti -
mouse CD25 
antibody PC61  BioLegend  102051  
5 530/30  TNF- 0.5 MP6-XT22  Alexa 488  Alexa Fluor®  488 
anti-mouse TNF -
 ant body, clone 
MP6-XT22  BioLegend  506313  
6 575/25  CD3 0.25 145-2C11  PE PE Hamster anti-
mouse CD3e clone 
145-2C11  BD 553064  
7 695/40   no  PerCP -Cy5.5     
8 780/60  IFN- 0.1 XMG1.2  Pe-Cy7 PE/Cy7 anti -
mouse IFN - 
antibody, clone 
XMG1.2  BioLegend  505826  
9 670/30  IL-2 0.5 JES6 -5H4 APC APC anti -mouse IL -2 
antibody  BioLegend  503810  
10 730/45   no  APC-R700     
11 780/60  dead  0.05-0.03  eFluor780  eBioscience™ 
Fixable Viability 
Dye eFluor™ 
780 ThermoFisher  65-0865 -14 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709000
  
 
R&D Report R -20-0085 Version 0 4 Page 66 of 93 
  Strictly Confidential  
96-well plate s: 
Plate 1: against S protein  
 1 2 3 4 5 6 7 8 9 10 11 12 
A pool*1 pool*1 pool*1 pool*1  1-1 1-1 1-1 1-1    
B pool*² pool*² pool*² pool*²  1-2 1-2 1-2 1-2    
C pool*³ pool*³ pool*³ pool*³  1-3 1-3 1-3 1-3    
D      1-4 1-4 1-4 1-4    
E      1-5 1-5 1-5 1-5    
F      1-6 1-6 1-6 1-6    
G      1-7 1-7 1-7 1-7    
H      1-8 1-8 1-8 1-8    
 
Plate 2: against S protein  
 1 2 3 4 5 6 7 8 9 10 11 12 
A 2-1 2-1 2-1 2-1 3-1 3-1 3-1 3-1 4-1 4-1 4-1 4-1 
B 2-2 2-2 2-2 2-2 3-2 3-2 3-2 3-2 4-2 4-2 4-2 4-2 
C 2-3 2-3 2-3 2-3 3-3 3-3 3-3 3-3 4-3 4-3 4-3 4-3 
D 2-4 2-4 2-4 2-4 3-4 3-4 3-4 3-4 4-4 4-4 4-4 4-4 
E 2-5 2-5 2-5 2-5 3-5 3-5 3-5 3-5 4-5 4-5 4-5 4-5 
F 2-6 2-6 2-6 2-6 3-6 3-6 3-6 3-6 4-6 4-6 4-6 4-6 
G 2-7 2-7 2-7 2-7 3-7 3-7 3-7 3-7 4-7 4-7 4-7 4-7 
H 2-8 2-8 2-8 2-8 3-8 3-8 3-8 3-8 4-8 4-8 4-8 4-8 
 
Plate 3: against RBD  
 1 2 4 5 5 6 7 8 9 10 11 12 
A 1-1 1-1  2-1 2-1  3-1 3-1  4-1 4-1  
B 1-2 1-2  2-2 2-2  3-2 3-2  4-2 4-2  
C 1-3 1-3  2-3 2-3  3-3 3-3  4-3 4-3  
D 1-4 1-4  2-4 2-4  3-4 3-4  4-4 4-4  
E 1-5 1-5  2-5 2-5  3-5 3-5  4-5 4-5  
F 1-6 1-6  2-6 2-6  3-6 3-6  4-6 4-6  
G 1-7 1-7  2-7 2-7  3-7 3-7  4-7 4-7  
H 1-8 1-8  2-8 2-8  3-8 3-8  4-8 4-8  
 * controls  1No Ab  ²CD3+ L/D   ³LD + CD3 + CD4 + 
CD8+ L/D  
      
 Medium only  Positive stimulus   S protein  
  RBD  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709001
  
 
R&D Report R -20-0085 Version 0 4 Page 67 of 93 
  Strictly Confidential  
Mastermixes for stimulation  
 
 
Mastermix for blocking reagents  
Blocking 
reagent  Volume 
needed/well 
[µL] Volume 
needed/mL 
[µL] Total 
wells  Total volume 
needed (ml; 
10 µL/well; 
incl 10% 
spare)  Volume 
blocking (µL)  Volume DC 
medium (µL)  
GolgiStop  0,13 13 192 2,112  27,46  2042,30  
GolgiPlug  0,2 20 192 2,112  42,24  
working concentration Stop (1:1500), Plug (1:1000)     
10 µL per well       
 
Stimulation protocol:  
1. Prepare a 96 -well tissue culture (F -well) 
2. Add 100  µL of stimulus (or medium) to the according well; “pool” on plates are FACS 
controls – 100 µL medium is sufficient  
3. Add 500,000 cells in DC medium per well (100  µL) 
4. Incubate plate for 1  h @ 37°C in 5% CO 2 
5. Add 10  µL of blocking reagents  
6. Swing plates (5 × 8-moves)  
7. Incubate for 5  h @37°C  in 5% CO 2 
8. Proceed with staining protocol or put plates in 4°C o/n  
 
Mastermix for L/D reagents  
 Live-dead 
reagent  Volume 
needed/well 
[µL] Volume 
needed/mL 
[µL] Total 
wells Total volume 
needed (ml; 
50 µL/well; 
incl 5% spare)  Volume L/D 
(µL) Volume PBS 
(µL) 
eFluor780  L/D 0,05 1 200 11 11,00  10989,00  
 working concentration Stop is 1:1000      
 50 µL per well       
 
Stimulusconcentration 
stock (mg/mL)concentration 
needed (mg/mL)concentration 
needed (mg/mL) * 
2Dilution factor total wellstotal volume 
needed (mL; 
100µl/well; incl 
10% spare)Volume stimulus 
(µL)Volume DC 
medium (µL)
Medium only - - - - 32 3,52 0 3520
PMA 1 0,0005 0,001 1000 32 3,52 3,52
Ionomycin 10 0,001 0,002 5000 32 3,52 0,70
S protein peptide 
mix 1158 peptide 15,8 254,84 64,00 7,04 27,63
S protein peptide 
mix 2157 peptide 15,7 253,23 64,00 7,04 27,80
RBD  peptides 48 peptides 1,2 0,0048 0,0096 125 64 7,04 56,32 6983,68
the S peptide stocks has a concentration of 100µg/mL per peptide; RBD has 25µg/mLPositive stimulus 3515,78
0,0315 0,062 6984,57
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709002
  
 
R&D Report R -20-0085 Version 0 4 Page 68 of 93 
  Strictly Confidential  
Antibody mix control 1 mastermix  
 Markers 
(extracellular)  µL per 
reaction 
(50 µL) Total 
wells  Volume Ab (µL)  Volume 
FACS buffer   
BV510  CD4 0,25 4 1,05 207,9  includes 5% spare 
volume  
BV421  CD8 0,25 4 1,05  
 
Antibody mix 1 mastermix  
 Markers 
(extracellular)  µL per 
reaction 
(50 µL) Total 
wells  Volume Ab (µL)  Volume 
FACS buffer 
(µL)  
BV421  CD8a  0,25 192 50,40  
9928,8  includes 5% spare 
volume  
BV510  CD4 0,25 192 50,40   
BV786  CD25  0,25 192 50,40   
 
Staining protocol:  
Note: work with a 4°C cooled centrifuge  
9. Mix cells by pipetting 3 × up and down and transfer total volume to ‘v’ bottom plate  
10. Centrifuge at 350  ×g, 5 min  
11. Wash cells once with 150-200 µL cold PBS  
12. Centrifuge at 350  ×g, 5 min. Discard supernatant  
a. Vortex cells carefully; snap against the wells to support pellet dissolving  
13. Stain with L/D reagen t 50 µL to each well in PBS at 4°C for 15  min 
14. Add 100  µL PBS  
15. Centrifuge at 350  ×g, 5 min. Discard supernatant; vortex/snap  
16. Add antibody master mix 1/antibody mix 1 controls /FACS buffer to each well 50  µL 
17. Incubate 30  min at 4°C 
18. Add 100  µL FACS buffer  
19. Centrifuge at 350  ×g, 5 min. Discard supernatant; vortex/snap  
20. Add 2% Histofix  
21. Incubate following  protocol a, b , or c: 
a. keep it in 4°C for overnight (up to ~16  h) if not proceeding for intracellular 
staining immediately  
b. incubate for at least  1 h at 4°C and 
i. proceed for intracellular staining or  
c. incubate for at least  1 h at 4°C 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709003
  
 
R&D Report R -20-0085 Version 0 4 Page 69 of 93 
  Strictly Confidential  
i. add 100  µL PBS  
ii. centrifuge at 400  ×g, 5 min. Discard supernatant; vortex/snap  
iii. add 100  µL PBS and keep it in 4°C until further usage (within ~36  h) 
iv. proceed with intracellular staining protocol  
 
Fc Block mastermix  
Fc Block  µL per 
reaction 
(25 µL) Total 
wells  Volume Ab (µL)  Volume perm  
buffer (µL)   
CD16/CD32  0,5 200 105 4935  includes 5% spare 
volume  
 
Antibody mix control 2 mastermix  
 Markers 
(extracellular)  µL per 
reaction 
(50 µL) Total 
wells  Volume Ab (µL)  Volume perm 
buffer (µL)   
PE CD3 0,25 4 1,05 208,95  includes 5% spare 
volume  
 
Antibody mix 2 mastermix  
 Markers 
(intracellular)  µL per 
reaction 
(25 µL) Total 
wells  Volume Ab (µL)  Volume perm 
buffer (µL)   
BV711  IL-4 0,25 192 50,40  
4717,44  includes 5% spare 
volume  
PE CD3 0,25 192 50,4  
Alexa 488  TNF- 0,5 192 100,80   
Pe-Cy7 IFN- 0,1 192 20,16   
APC IL-2 0,5 192 100,80   
 
Intracellular s taining protocol:  
1. Centrifuge at 400  ×g, 5 min, 4°C. Discard supernatant, vortex/snap  
2. Suspend cells with perm buffer, 150  µL each well  
3. Centrifuge at 400  ×g, 5 min, 4°C. Discard supernatant, vortex/snap  
4. Add Fc block 25  µL amount, to each well, incubate for 10  min 
5. Add 25  µL of the antibody master mix 2/ antibody mix 2 controls/FACS buffer to the 
cells, mix carefully and incubate for another 45  min, 2 -8°C 
6. Add 100  µL 1× Perm buffer  
7. Centrifuge at 400 ×g, 5 min, 4°C. Discard supernatant, vortex/snap  
8. Add 200  µL 1× Perm buffer  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709004
  
 
R&D Report R -20-0085 Version 0 4 Page 70 of 93 
  Strictly Confidential  
9. Centrifuge at 400  ×g, 5 min, 4°C. Discard supernatant, vortex/snap  
10. Discard the supernatant carefully  
11. Resuspend the cells carefully in 100  µL FACS buffer or FACS flow  
12. Mix cells b y pipetting 3 × up and down and transfer total volume to ‘U’ bottom plate for 
FACS Celesta/HTS a cquire  
13. Store plate at 4°C until time point  of measurement/flow cytometry  
a. Note that the plates should be acquired the same day as the intracellular 
staining may d ecrease in signal.  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709005
  
 
R&D Report R -20-0085 Version 0 4 Page 71 of 93 
  Strictly Confidential  
Appendix  6: Statistical Analysis  
ELISA  
Descriptive statistics, ELISA screening analysis, day 7, S1  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,00 0,362  0,544  1,35 
Maximum  0,00100  1,22 1,59 2,05 
Range  0,00100  0,858  1,05 0,704  
Mean  0,000125  0,872  1,14 1,74 
SD 0,000354  0,321  0,373  0,245  
SEM  0,000125  0,113  0,132  0,0867  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, ELISA screening analysis, day 14, S1  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,00 0,724  1,09 1,71 
Maximum  0,0100  1,53 1,80 2,11 
Range  0,0100  0,809  0,713  0,407  
Mean  0,00325  1,18 1,45 1,88 
SD 0,00388  0,299  0,218  0,143  
SEM  0,00137  0,106  0,0772  0,0504  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, ELISA screening analysis, day 21, S1  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,00 0,815  1,36 1,97 
Maximum  0,0100  1,67 2,04 2,33 
Range  0,0100  0,858  0,672  0,357  
Mean  0,00138  1,24 1,67 2,12 
SD 0,00350  0,327  0,219  0,122  
SEM  0,00124  0,116  0,0775  0,0430  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709006
  
 
R&D Report R -20-0085 Version 0 4 Page 72 of 93 
  Strictly Confidential  
One-way ANOVA with Dunnett’s multiple comparisons post -test, ELISA screening 
analysis, day 7, S1  
ANOVA summary   
F 55,55  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,8562  
Please note that commas are used as decimal separators.  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -0,8714  -1,213 to -0,5301  Yes **** <0,0001  
Buffer vs. 1 µg  -1,135  -1,477 to -0,7940  Yes **** <0,0001  
Buffer vs. 5 µg  -1,745  -2,086 to -1,403  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, ELISA screening 
analysis, day 14, S1  
ANOVA summary   
F 131,1  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,9335  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -1,179  -1,425 to -0,9326  Yes **** <0,0001  
Buffer vs. 1 µg  -1,449  -1,695 to -1,202  Yes **** <0,0001  
Buffer vs. 5 µg  -1,875  -2,121 to -1,629  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709007
  
 
R&D Report R -20-0085 Version 0 4 Page 73 of 93 
  Strictly Confidential  
One-way ANOVA with Dunnett’s multiple comparisons post -test, ELISA screening 
analysis, day 21, S1  
ANOV A summary   
F 156,3  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,9436  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -1,240  -1,496 to -0,9841  Yes **** <0,0001  
Buffer vs. 1 µg  -1,672  -1,928 to -1,417  Yes **** <0,0001  
Buffer vs. 5 µg  -2,115  -2,370 to -1,859  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
Descriptive statistics, ELISA screening analysis, day 7 , RBD  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of  values  8 8 8 8 
Minimum  0,00 0,253  0,869  1,51 
Maximum  0,00800  1,57 1,84 2,17 
Range  0,00800  1,32 0,971  0,661  
Mean  0,00288  0,930  1,38 1,85 
SD 0,00270  0,473  0,330  0,221  
SEM  0,000953  0,167  0,117  0,0783  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, ELISA screening analysis, day 14 , RBD  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,00 0,920  1,18 1,84 
Maximum  0,0130  1,64 1,96 2,39 
Range  0,0130  0,720  0,785  0,550  
Mean  0,00388  1,28 1,57 2,07 
SD 0,00476  0,293  0,265  0,195  
SEM  0,00168  0,104  0,0936  0,0690  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709008
  
 
R&D Report R -20-0085 Version 0 4 Page 74 of 93 
  Strictly Confidential  
Descriptive statistics, ELISA screening analysis, day 21, RBD  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,00100  0,747  1,56 2,04 
Maximum  0,00400  1,65 1,98 2,40 
Range  0,00300  0,907  0,424  0,362  
Mean  0,00250  1,20 1,82 2,21 
SD 0,00107  0,392  0,150  0,140  
SEM  0,000378  0,138  0,0529  0,0493  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, ELISA screening 
analysis, day 7 , RBD  
ANOVA summary   
F 52,18  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,8483  
Please note that commas are used as decimal separators.  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -0,9270  -1,311 to -0,5432  Yes **** <0,0001  
Buffer vs. 1 µg  -1,381  -1,765 to -0,9975  Yes **** <0,0001  
Buffer vs. 5 µg  -1,852  -2,236 to -1,468  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, ELISA s creening 
analysis, day 14 , RBD  
ANOVA summary   
F 128,0  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,9320  
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709009
  
 
R&D Report R -20-0085 Version 0 4 Page 75 of 93 
  Strictly Confidential  
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -1,274  -1,547 to -1,000  Yes **** <0,0001  
Buffer vs. 1 µg  -1,571  -1,844 to -1,297  Yes **** <0,0001  
Buffer vs. 5 µg  -2,065  -2,338 to -1,791  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F-statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, ELISA screening 
analysis, day 21, RBD  
ANOVA summary   
F 152,6  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,9424  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2  µg -1,198  -1,472 to -0,9232  Yes **** <0,0001  
Buffer vs. 1 µg  -1,813  -2,087 to -1,539  Yes **** <0,0001  
Buffer vs. 5 µg  -2,211  -2,485 to -1,937  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
Descriptive statistics, ELISA, IgG concentrations, day 28, S1  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,00 35,8 117 312 
Maximum  0,00 117 289 536 
Range  0,00 81,5 172 224 
Mean  0,00 73,0 206 393 
SD 0,00 29,3 59,3 81,7 
SEM  0,00 10,4 21,0 28,9 
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709010
  
 
R&D Report R -20-0085 Version 0 4 Page 76 of 93 
  Strictly Confidential  
Descriptive statistics, ELISA, IgG concentrations, day 28, RBD  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,00 36,7 161 345 
Maximum  0,00 129 298 583 
Range  0,00 92,8 137 238 
Mean  0,00 83,1 242 449 
SD 0,00 34,9 48,5 80,9 
SEM  0,00 12,3 17,2 28,6 
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
One-way ANOVA with Dunnett’s  multiple comparisons post -test, ELISA, IgG 
concentrations, day 28, S1  
ANOVA summary   
F 86,02  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,9021  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -72,97  -138,3 to -7,684  Yes * 0,0259  
Buffer vs. 1 µg  -205,9  -271,2 to -140,6  Yes **** <0,0001  
Buffer vs. 5 µg  -392,7  -458,0 to -327,4  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, ELISA, IgG 
concentrations, day 28, RBD  
ANOVA summary   
F 123,4  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,9297  
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709011
  
 
R&D Report R -20-0085 Version 0 4 Page 77 of 93 
  Strictly Confidential  
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -83,10  -145,5 to -20,66  Yes ** 0,0072  
Buffer vs. 1 µg  -241,7  -304,2 to -179,3  Yes **** <0,0001  
Buffer vs. 5 µg  -448,6  -511,0 to -386,1  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F-statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
One-way ANOVA with Tukey ’s multiple comparisons post -test, ELISA, reciprocal 
serum endpoint titer , S1 
ANOVA summary   
F 13,76  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,6276  
 
Tukey ’s multiple 
comparisons test  Mean diff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg (day 
14) -66525  -470716 to 337666  No ns 0,9987  
Buffer vs. 1 µg (day 14)  -84750  -488941 to 319441  No ns 0,9949  
Buffer vs. 5 µg (day 14)  -291300  -695491 to 112891  No ns 0,3063  
Buffer vs. 0.2 µg (day 
28) -163725  -567916 to 240466  No ns 0,8727  
Buffer vs. 1 µg (day 28)  -491775  -895966 to -87584  Yes ** 0,0082  
Buffer vs. 5 µg (day 28)  -983850  -1388041 to -579659  Yes **** <0,0001  
0.2 µg (day 14) vs. 1 µg 
(day 14)  -18225  -422416 to 385966  No ns >0,9999  
0.2 µg (day 14) vs. 5 µg 
(day 14)  -224775  -628966 to 179416  No ns 0,6131  
0.2 µg (day 14) vs. 0.2 
µg (day 28)  -97200  -501391 to 306991  No ns 0,9893  
0.2 µg (day 14) vs. 1 µg 
(day 28)  -425250  -829441 to -21059  Yes * 0,0332  
0.2 µg (day 14) vs. 5 µg 
(day 28)  -917325  -1321516 to -513134  Yes **** <0,0001  
1 µg (day 14) vs. 5 µg 
(day 14)  -206550  -610741 to 197641  No ns 0,7009  
1 µg (day 14) vs. 0.2 µg 
(day 28)  -78975  -483166 to 325216  No ns 0,9965  
1 µg (day 14) vs. 1 µg 
(day 28)  -407025  -811216 to -2834  Yes * 0,0474  
1 µg (day 14) vs. 5 µg 
(day 28)  -899100  -1303291 to -494909  Yes **** <0,0001  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709012
  
 
R&D Report R -20-0085 Version 0 4 Page 78 of 93 
  Strictly Confidential  
Tukey ’s multiple 
comparisons test  Mean diff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
5 µg (day 14) vs. 0.2 µg 
(day 28)  127575  -276616 to 531766  No ns 0,9580  
5 µg (day 14) vs. 1 µg 
(day 28)  -200475  -604666 to 203716  No ns 0,7289  
5 µg (day 14) vs. 5 µg 
(day 28)  -692550  -1096741 to -288359  Yes **** <0,0001  
0.2 µg (day 28) vs. 1 µg 
(day 28)  -328050  -732241 to 76141  No ns 0,1837  
0.2 µg (day 28) vs. 5 µg 
(day 28)  -820125  -1224316 to -415934  Yes **** <0,0001  
1 µg (day 28) vs. 5 µg 
(day 28)  -492075  -896266 to -87884  Yes ** 0,0081  
 
One-way ANOVA with Tukey ’s multiple comparisons post -test, ELISA, reciprocal 
serum endpoint titer , RBD  
ANOVA summary   
F 17,63  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,6834  
 
Tukey’ s multiple 
comparisons test  Mean diff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg (day 
14) -66525  -250933 to 117883  No ns 0,9224  
Buffer vs. 1 µg (day 14)  -78675  -263083 to 105733  No ns 0,8433  
Buffer vs. 5 µg (day 14)  -327750  -512158  to -143342  Yes **** <0,0001  
Buffer vs. 0.2 µg (day 
28) -60450  -244858 to 123958  No ns 0,9498  
Buffer vs. 1 µg (day 28)  -218400  -402808 to -33992  Yes * 0,0109  
Buffer vs. 5 µg (day 28)  -491775  -676183 to -307367  Yes **** <0,0001  
0.2 µg (day 14) vs. 1 µg 
(day 14)  -12150  -196558 to 172258  No ns >0,9999  
0.2 µg (day 14) vs. 5 µg 
(day 14)  -261225  -445633 to -76817  Yes ** 0,0012  
0.2 µg (day 14) vs. 0.2 
µg (day 28)  6075  -178333 to 190483  No ns >0,9999  
0.2 µg (day 14) vs. 1 µg 
(day 28)  -151875  -336283 to 32533  No ns 0,1707  
0.2 µg (day 14) vs. 5 µg 
(day 28)  -425250  -609658 to -240842  Yes **** <0,0001  
1 µg (day 14) vs. 5 µg 
(day 14)  -249075  -433483 to -64667  Yes ** 0,0024  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709013
  
 
R&D Report R -20-0085 Version 0 4 Page 79 of 93 
  Strictly Confidential  
Tukey’ s multiple 
comparisons test  Mean diff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
1 µg (day 14) vs. 0.2 µg 
(day 28)  18225  -166183 to 202633  No ns >0,9999  
1 µg (day 14) vs. 1 µg 
(day 28)  -139725  -324133 to 44683  No ns 0,2513  
1 µg (day 14) vs. 5 µg 
(day 28)  -413100  -597508 to -228692  Yes **** <0,0001  
5 µg (day 14) vs. 0.2 µg 
(day 28)  267300  82892 to 451708  Yes *** 0,0009  
5 µg (day 14) vs. 1 µg 
(day 28)  109350  -75058 to 293758  No ns 0,5396  
5 µg (day 14) vs. 5 µg 
(day 28)  -164025  -348433 to 20383  No ns 0,1112  
0.2 µg (day 28) vs. 1 µg 
(day 28)  -157950  -342358 to 26458  No ns 0,1385  
0.2 µg (day 28) vs. 5 µg 
(day 28)  -431325  -615733 to -246917  Yes **** <0,0001  
1 µg (day 28) vs. 5 µg 
(day 28)  -273375  -457783 to -88967  Yes *** 0,0007  
 
Descriptive statistics, IgG subtype -specific ELISA, day 28, IgG1  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,00 0,498  1,04 1,71 
Maximum  0,00300  1,57 1,70 2,68 
Range  0,00300  1,07 0,651  0,966  
Mean  0,000375  1,00 1,40 2,20 
SD 0,00106  0,399  0,229  0,319  
SEM  0,000375  0,141  0,0811  0,113  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, IgG subtype -specific ELISA, day 28, IgG2 a 
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,00 0,206  0,811  2,21 
Maximum  0,00100  1,48 2,37 2,68 
Range  0,00100  1,27 1,56 0,462  
Mean  0,000125  0,640  1,82 2,48 
SD 0,000354  0,399  0,515  0,167  
SEM  0,000125  0,141  0,182  0,0589  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709014
  
 
R&D Report R -20-0085 Version 0 4 Page 80 of 93 
  Strictly Confidential  
One-way ANOVA with Dunnett’s  multiple comparisons post -test, IgG subtype -specific 
ELISA, day 28, IgG1  
ANOVA summary   
F 85,19  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,9013  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -1,004  -1,351 to -0,6567  Yes **** <0,0001  
Buffer vs. 1 µg  -1,396  -1,743 to -1,049  Yes **** <0,0001  
Buffer vs. 5 µg  -2,197  -2,544 to -1,849  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
One-way ANOVA with Dunnett’s multiple comparisons  post-test, IgG subtype -specific 
ELISA, day 28, IgG2 a 
ANOVA summary   
F 88,60  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,9047  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -0,6398  -1,057 to -0,2221  Yes ** 0,0020  
Buffer vs. 1 µg  -1,821  -2,238 to -1,403  Yes **** <0,0001  
Buffer vs. 5 µg  -2,475  -2,893 to -2,057  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709015
  
 
R&D Report R -20-0085 Version 0 4 Page 81 of 93 
  Strictly Confidential  
Descriptive statistics, ELISA, IgG2a/IgG1 ratio, day 28  
 0.2 µg  1 µg 5 µg 
Number of values  8 8 8 
Minimum  0,272  0,777  0,827  
Maximum  1,27 1,81 1,56 
Range  0,998  1,03 0,737  
Mean  0,635  1,29 1,15 
SD 0,307  0,311  0,227  
SEM  0,109  0,110  0,0804  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
One-way ANOVA with Tukey’s multiple comparisons post -test ELISA, IgG2a/IgG1 
ratio, day 28  
ANOVA summary   
F 11,92  
P value  0,0003  
P valu e summary  *** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,5317  
 
Tukey’ s multiple 
comparisons test  Mean diff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
0.2 µg vs. 1 µg  -0,6595  -1,018 to -0,3009  Yes *** 0,0004  
0.2 µg vs. 5 µg  -0,5186  -0,8771 to -0,1600  Yes ** 0,0041  
1 µg vs. 5 µg  0,1409  -0,2177 to 0,4995  No ns 0,5907  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
Pseudovirus -based neutralization test  
Descriptive statistics, pVNT, day 14  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  6,00 6,00 12,0 48,0 
Maximum  6,00 96,0 192 192 
Range  0,00 90,0 180 144 
Mean  6,00 21,8 46,5 90,0 
SD 0,00 31,1 59,6 47,6 
SEM  0,00 11,0 21,1 16,8 
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709016
  
 
R&D Report R -20-0085 Version 0 4 Page 82 of 93 
  Strictly Confidential  
Descriptive statistics, pVNT, day 21  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  6,00 6,00 48,0 96,0 
Maximum  6,00 96,0 384 384 
Range  0,00 90,0 336 288 
Mean  6,00 30,8 144 228 
SD 0,00 31,3 112 102 
SEM  0,00 11,1 39,5 36,0 
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, pVNT, day 28  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  6,00 12,0 96,0 192 
Maximum  6,00 96,0 384 384 
Range  0,00 84,0 288 192 
Mean  6,00 33,0 192 312 
SD 0,00 27,8 88,9 99,4 
SEM  0,00 9,82 31,4 35,1 
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, pVNT, day 14  
ANOVA summary   
F 6,330  
P value  0,0021  
P valu e summary  ** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,4041  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -15,75  -66,89 to 35,39  No ns 0,7862  
Buffer vs. 1 µg  -40,50  -91,64 to 10,64  No ns 0,1440  
Buffer vs. 5 µg  -84,00  -135,1 to -32,86  Yes *** 0,0010  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709017
  
 
R&D Report R -20-0085 Version 0 4 Page 83 of 93 
  Strictly Confidential  
One-way ANOVA with Dunnett’s multiple comparisons post -test, pVNT, day 21  
ANOVA summary   
F 14,28  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,6047  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -24,75  -120,6 to 71,14  No ns 0,8582  
Buffer vs. 1 µg  -138,0  -233,9 to -42,11  Yes ** 0,0036  
Buffer vs. 5 µg  -222,0  -317,9 to -126,1  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, pVNT, day 28  
ANOVA summary   
F 35,44  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,7916  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -27,00  -111,5 to 57,54  No ns 0,7684  
Buffer vs. 1 µg  -186,0  -270,5 to -101,5  Yes **** <0,0001  
Buffer vs. 5 µg  -306,0  -390,5 to -221,5  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709018
  
 
R&D Report R -20-0085 Version 0 4 Page 84 of 93 
  Strictly Confidential  
ELIS pot analysis  
Descriptive statistics, day 28, fresh splenocytes, S protein  
 Buffer control  0.2 µg 1 µg 
Number of values  8 8 8 
Minimum  6,00 228 858 
Maximum  13,7 626 1334  
Range  7,67 399 477 
Mean  8,54 334 1054  
SD 2,72 134 177 
SEM  0,961  47,4 62,6 
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, day 28, fresh splenocytes, RBD  
 Buffer control  0.2 µg 1 µg 
Number of values  8 8 8 
Minimum  1,67 20,0 33,0 
Maximum  8,00 73,0 126 
Range  6,33 53,0 93,3 
Mean  4,46 36,3 87,3 
SD 1,90 19,6 29,2 
SEM  0,672  6,93 10,3 
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, day 28 , fresh 
splenocytes, S protein  
ANOVA summary   
F 139,2  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,9299  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -325,0  -477,0 to -173,0  Yes *** 0,0001  
Buffer vs. 1 µg -1045  -1197 to -893,3  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709019
  
 
R&D Report R -20-0085 Version 0 4 Page 85 of 93 
  Strictly Confidential  
One-way ANOVA with Dunnett’s multiple comparisons post -test, day 28 , fresh 
splenocytes, RBD  
ANOVA summary   
F 33,83  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,7631  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -31,83  -55,90 to -7,763  Yes ** 0,0094  
Buffer vs. 1 µg  -82,79  -106,9 to -58,72  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
Descriptive statistics, day 28 , frozen splenocytes, S protein  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,667  24,7 157 51,7 
Maximum  4,67 137 277 232 
Range  4,00 112 121 180 
Mean  2,13 76,4 206 139 
SD 1,49 35,9 52,3 66,7 
SEM  0,527  12,7 18,5 23,6 
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, day 28, frozen splenocytes, RBD  
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,333  1,33 12,3 4,67 
Maximum  4,67 20,0 33,0 42,7 
Range  4,33 18,7 20,7 38,0 
Mean  2,63 9,38 21,8 17,9 
SD 1,20 6,72 7,21 12,0 
SEM  0,425  2,38 2,55 4,25 
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709020
  
 
R&D Report R -20-0085 Version 0 4 Page 86 of 93 
  Strictly Confidential  
One-way ANOVA with Dunnett’s  multiple comparisons post -test, day 28 , frozen 
splenocytes, S protein  
ANOVA summary   
F 28,56  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,7537  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -74,25  -131,4 to -17,11  Yes ** 0,0087  
Buffer vs. 1 µg  -203,6  -260,8 to -146,5  Yes **** <0,0001  
Buffer vs. 5 µg  -136,5  -193,6 to -79,32  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, day 28 , frozen 
splenocytes, RBD  
ANOVA summary   
F 9,726  
P value  0,0001  
P valu e summary  *** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,5103  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -6,750  -16,43 to 2,933  No ns 0,2210  
Buffer vs. 1 µg  -19,17  -28,85 to -9,484  Yes *** 0,0001  
Buffer vs. 5 µg  -15,25  -24,93 to -5,567  Yes ** 0,0015  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709021
  
 
R&D Report R -20-0085 Version 0 4 Page 87 of 93 
  Strictly Confidential  
Descriptive statistics, day 28, ELISpot after MACS  
 CD4 CD8 
AH-1 RBD  S AH-1 RBD  S 
Number of values  8 8 8 8 8 8 
Minimum  0,00 1,50 66,0 1,00 21,5 173 
Maximum  4,50 23,0 155 3,50 62,5 477 
Range  4,50 21,5 89,0 2,50 41,0 304 
Mean  1,81 13,0 98,8 2,19 43,6 287 
SD 1,62 7,75 34,6 0,843  15,6 104 
SEM  0,574  2,74 12,2 0,298  5,51 36,9 
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, day 28, ELISpot after 
MACS, CD4+ 
ANOVA summary   
F 53,66  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,8363  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
AH-1 vs. RBD  -11,19  -35,47 to 13,10  No ns 0,4568  
AH-1 vs. S -97,00  -121,3 to -72,71  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709022
  
 
R&D Report R -20-0085 Version 0 4 Page 88 of 93 
  Strictly Confidential  
One-way ANOVA  with Dunnett’s multiple comparisons post -test, day 28, ELISpot after 
MACS, CD8+ 
ANOVA summary   
F 51,01  
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,8293  
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
AH-1 vs. RBD  -41,44  -113,6 to 30,70  No ns 0,3119  
AH-1 vs. S -284,5  -356,6 to -212,4  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
Intracellular cytokine staining  
Descriptive statistics, ICS, CD4+, IFN - 
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,0500  0,110  0,115  0,0730  
Maximum  0,104  0,175  0,220  0,240  
Range  0,0540  0,0650  0,105  0,167  
Mean  0,0858  0,145  0,159  0,119  
SD 0,0172  0,0220  0,0317  0,0550  
SEM  0,00606  0,00779  0,0112  0,0194  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, ICS, CD4+, IL-4 
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,0750  0,0695  0,0780  0,0590  
Maximum  0,110  0,129  0,120  0,184  
Range  0,0350  0,0590  0,0420  0,125  
Mean  0,0934  0,107  0,101  0,0968  
SD 0,0116  0,0180  0,0163  0,0471  
SEM  0,00411  0,00638  0,00577  0,0166  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709023
  
 
R&D Report R -20-0085 Version 0 4 Page 89 of 93 
  Strictly Confidential  
Descriptive statistics, ICS, CD4+, TNF - 
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,0740  0,0785  0,150  0,130  
Maximum  0,170  0,155  0,250  0,265  
Range  0,0960  0,0765  0,100  0,135  
Mean  0,0992  0,113  0,190  0,193  
SD 0,0305  0,0243  0,0317  0,0514  
SEM  0,0108  0,00858  0,0112  0,0182  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, ICS, CD4+, IL-2 
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,0685  0,110  0,130  0,0995  
Maximum  0,130  0,235  0,220  0,660  
Range  0,0615  0,125  0,0900  0,561  
Mean  0,0968  0,158  0,175  0,223  
SD 0,0210  0,0365  0,0331  0,195  
SEM  0,00741  0,0129  0,0117  0,0689  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, ICS, CD4+, IFN - 
ANOVA summary   
F 20 
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,66 
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -0,059  -0,088 to -0,030  Yes *** 0,0002  
Buffer vs. 1 µg  -0,073  -0,10 to -0,044  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709024
  
 
R&D Report R -20-0085 Version 0 4 Page 90 of 93 
  Strictly Confidential  
One-way ANOVA with Dunnett’s multiple comparisons post -test, ICS, CD4+, IL-4 
ANOVA summary   
F 1,6 
P value  0,2304  
P valu e summary  ns 
Significant diff. among means (P < 0.05)?  No 
R square  0,13 
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. ns: Not significant.  
 
No post -test for insignificant main test.  
One-way ANOVA with Dunnett’s multiple comparisons post -test, ICS, CD4+, TNF - 
ANOVA summary   
F 23 
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,69 
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -0,013  -0,048 to 0,021  No ns 0,5633  
Buffer vs. 1 µg  -0,091  -0,13 to -0,056  Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not signi ficant.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, ICS, CD4+, IL-2 
ANOVA summary   
F 14 
P value  0,0001  
P valu e summary  *** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,57 
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -0,061  -0,097 to -0,024  Yes ** 0,0015  
Buffer vs. 1 µg  -0,078  -0,11 to -0,042  Yes *** 0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709025
  
 
R&D Report R -20-0085 Version 0 4 Page 91 of 93 
  Strictly Confidential  
Descriptive statistics, ICS, CD8+, IFN - 
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,0340  0,190  0,435  0,210  
Maximum  0,102  0,700  0,875  0,645  
Range  0,0680  0,510  0,440  0,435  
Mean  0,0594  0,361  0,704  0,463  
SD 0,0223  0,162  0,141  0,134  
SEM  0,00789  0,0572  0,0500  0,0472  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, ICS, CD8+, TNF - 
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,104  0,270  0,450  0,270  
Maximum  0,205  0,750  0,945  0,670  
Range  0,102  0,480  0,495  0,400  
Mean  0,150  0,410  0,723  0,524  
SD 0,0350  0,162  0,154  0,134  
SEM  0,0124  0,0571  0,0543  0,0475  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
 
Descriptive statistics, ICS, CD8+, IL-2 
 Buffer control  0.2 µg 1 µg 5 µg 
Number of values  8 8 8 8 
Minimum  0,0585  0,165  0,170  0,135  
Maximum  0,117  0,290  0,400  0,555  
Range  0,0580  0,125  0,230  0,420  
Mean  0,0840  0,214  0,286  0,268  
SD 0,0198  0,0504  0,0794  0,172  
SEM  0,00699  0,0178  0,0281  0,0608  
Please note that commas are used as decimal separators. SD: Standard deviation. SEM: Standard error of the 
mean.  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709026
  
 
R&D Report R -20-0085 Version 0 4 Page 92 of 93 
  Strictly Confidential  
One-way ANOVA with Dunnett’s multiple comparisons post -test, ICS, CD8+, IFN - 
ANOVA summary   
F 54 
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,84 
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -0,30 -0,45 to -0,15 Yes *** 0,0002  
Buffer vs. 1 µg  -0,64 -0,79 to -0,50 Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
One-way ANOVA with Dunnett’s multiple comparisons post -test, ICS, CD8+, TNF - 
ANOVA summary   
F 39 
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,79 
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff. Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -0,26 -0,41 to -0,11 Yes ** 0,0013  
Buffer vs. 1 µg  -0,57 -0,73 to -0,42 Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
  
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709027
  
 
R&D Report R -20-0085 Version 0 4 Page 93 of 93 
  Strictly Confidential  
One-way ANOVA with Dunnett’s multiple comparisons post -test, ICS, CD8+, IL-2 
ANOVA summary   
F 27 
P value  <0,0001  
P valu e summary  **** 
Significant diff. among means (P < 0.05)?  Yes 
R square  0,72 
 
Dunnett’s  multiple 
comparisons test  Mean d iff. 95,00% CI of diff.  Significant?  Summary  Adjusted P 
value 
Buffer vs. 0.2 µg  -0,13 -0,20 to -0,064  Yes *** 0,0003  
Buffer vs. 1 µg  -0,20 -0,27 to -0,14 Yes **** <0,0001  
Please note that commas are used as decimal separators. F: F -statistic . P values ≤  0.05 indicate statistically 
significant difference. R square: Coefficient of determination. CI: Confidence interval. n.s.: Not significant.  
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
FDA-CBER-2021-5683-0709028
1Von:
Gesendet: Montag, 23. November 2020 14:17
An:
Cc:
Betreff: Final R-20-0085 version 4.0 report, with signatures
Anlagen: R-20-0085 modRNA V9_Report_V4.0_signatures.pdf
Kennzeichnung: Zur Nachverfolgung
Kennzeichnungsstatus: Gekennzeichnet
Hi , 
 Attached here is the final updated PDF for R-20-0085 version 4.  With this email, I’m giving my approval as Author. I’ll 
wet-ink sign this document when I’m next in Mainz.   Best, 
 
 
 
BioNTech SE 
 
090177e19598ca29\Approved\Approved On: 23-Nov-2020 20:20 (GMT)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
FDA-CBER-2021-5683-0709029