125742 S1 M4 4.2.1 r 20 0112

Pfizer Documents (PHMPT/FDA)

Pfizer Bla Submission

Pfizer 16 Plus Documents

105

Document text

BioNTec h SE  
An der Goldgrube 12  
55131 Mainz, Germany  
Phone: +49 (0)6131 9084 -0 
Telefax: +49 (0)6131 9084 -390 
R&D STUDY REPORT N o. R-20-0112 
CHARACTERIZING THE I MMUNOPHENOTYPE IN 
SPLEEN AND LYMPH NOD E OF MICE TREATED 
WITH SARS -COV-2 VACCINE CANDIDATES  
Version 01 
Date:  13 AUG 2020   
Reported by  
Test item: BNT162a1, BNT162b1, BNT162b2, BNT162c2  
Key w ords: Covid -19, SARS -CoV-2, Vaccine, BALB/c mice, immunophenotyping  
This R&D report  consists of 105 pages.  
Confidentiality Statement: The information contained in this document is the property and copyright of  
BioNTech RNA Pharmaceuticals GmbH . Therefore, this document is provided in confidence to the recipient (e.g. 
regulatory authorities, IECs/IRBs, investigato rs, auditors, inspectors). No information contained herein shall be 
published, disclosed , or reproduced without prior written approval of the proprietors.  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
FDA-CBER-2021-5683-0709030
  
 
R&D Report R -20-0112  Version 01  Page 2 of 105 
  Strictly Confidential  
TABLE OF CONTENTS  
LIST OF FIGURE S ................................ ................................ ...............  5 
LIST OF TABLES  ................................ ................................ .................  5 
LIST OF ABBREVIATION S ................................ ................................ . 8 
RESPONSIBILITIES  ................................ ................................ ............ 9 
1 SUMMARY  ................................ ................................ .........................  10 
2 GENERAL INFORMATION  ................................ ................................  12 
2.1 Sponsor and Test Facilities  ................................ ................................  12 
2.2 Participating Personnel  ................................ ................................ ....... 12 
2.3 Study Dates  ................................ ................................ ........................  13 
2.4 Guidelines and Regulations  ................................ ................................  14 
2.5 Changes and Deviations  ................................ ................................ ..... 14 
2.6 Documentation and Archive  ................................ ................................  20 
3 INTRODUCTI ON ................................ ................................ ................  22 
3.1 Background  ................................ ................................ ........................  22 
3.2 Objectives  ................................ ................................ ...........................  23 
3.3 Study Design  ................................ ................................ ......................  23 
4 MATERIALS AND METHOD S ................................ ...........................  27 
4.1 Test Item  ................................ ................................ .............................  27 
4.2 Control Item  ................................ ................................ ........................  27 
4.3 Test System  ................................ ................................ ........................  27 
4.4 Materials  ................................ ................................ .............................  27 
4.5 Methods  ................................ ................................ ..............................  34 
4.5.1  Animal Care  ................................ ................................ ........................  34 
4.5.1.1  General Information  ................................ ................................ ............  34 
4.5.1.2  Housing Condition and Husbandry  ................................ .....................  34 
4.5.2  Animal Monitoring  ................................ ................................ ...............  34 
4.5.3  Animal Treatment  ................................ ................................ ...............  35 
4.5.3.1  Treatment Schedul e, Route of Administration, and Dose  ...................  35 
4.5.3.2  Immunization  ................................ ................................ ......................  35 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709031
  
 
R&D Report R -20-0112  Version 01  Page 3 of 105 
  Strictly Confidential  
4.5.3.3  Blood Sampling via the Retro -Orbital Venous Plexus or Vena 
Facialis  ................................ ................................ ...............................  35 
4.5.4  Endpoint of Experiment / Termination Criteria  ................................ .... 36 
4.5.4.1  Dissection of Animals and Organ Collection  ................................ ....... 36 
4.5.5  Preparation of Splenocyte Single Cell Suspensions  ...........................  36 
4.5.6  Preparation of Lymph Node Single Cell Suspensions  ........................  37 
4.5.7  RNA Electroporation  ................................ ................................ ...........  37 
4.5.8  ELISpot Assay  ................................ ................................ ....................  37 
4.5.9  xCELLigence Cytotoxicity Assay  ................................ ........................  38 
4.5.10  Cytokine Multiplex Protein Quantification  ................................ ...........  38 
4.5.11  Flow Cytometry  ................................ ................................ ...................  39 
4.5.11.1  Restimulation of T cells for functional T cell analysis in the spleen and 
dLN ................................ ................................ ................................ ..... 39 
4.5.11.2  Functional T cell analysis in the spleen and dLN  ................................  39 
4.5.11.3  Phenotypic T cell analysis in the spleen and dLN  ...............................  42 
4.5.11.4  Phenotypic T cell analysis in the blood  ................................ ...............  44 
4.5.11.5  B cell analysis in the spleen and dLN  ................................ .................  47 
4.5.11.6  Myeloid cell analysis in the spleen  ................................ ......................  50 
4.5.12  Statistical Analysis  ................................ ................................ ..............  51 
5 RESULTS  ................................ ................................ ...........................  53 
5.1 ELISpot assay ................................ ................................ .....................  53 
5.2 Flow Cytometry  ................................ ................................ ...................  54 
5.3 Cytokine Multiplex Assay  ................................ ................................ .... 59 
5.4 xCELLigence Cytotoxicity Assay  ................................ ........................  61 
6 CONCLUSION  ................................ ................................ ....................  64 
7 DOCUMENT HISTORY  ................................ ................................ ...... 65 
8 REFERENCES  ................................ ................................ ...................  66 
9 APPENDIX  ................................ ................................ .........................  67 
9.1 Animal Monitoring  ................................ ................................ ...............  67 
9.2 Animal Monitoring - Observations  ................................ .......................  67 
9.3 ELISpot – Raw dat a ................................ ................................ ............  73 
9.4 Cytokine multiplex analysis – Assay detection ranges  ........................  75 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709032
  
 
R&D Report R -20-0112  Version 01  Page 4 of 105 
  Strictly Confidential  
9.5 Cytokine multiplex analysis – Raw data and calculated data  ..............  76 
9.6 Certificates of Analysis BNT162a1  ................................ .....................  88 
9.7 Certificates of Analysis BNT162b1  ................................ .....................  90 
9.8 Certificates of Analysis BNT162b2  ................................ .....................  93 
9.9 Certificates of Analysis BNT162c2  ................................ ......................  96 
9.10  Statistical analysis  ................................ ................................ ..............  98 
9.11  List of attachments  ................................ ................................ ............  104  
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709033
  
 
R&D Report R -20-0112  Version 01  Page 5 of 105 
  Strictly Confidential  
LIST OF FIGURE S 
Figure  1: Schematic overview of the S protein structure of the SARS -CoV S protein
 ................................ ................................ ................................ ............................  22 
Figure  2: Workflow of part 1 of the study (mCorVac#15)  ................................ ..... 25 
Figure  3: Workflow of part 2 of the study (mCorVac#16)  ................................ ..... 25 
Figure  4: Analysis and assay overview  ................................ ................................  26 
Figure  5: Draining lymph nodes resection for subsequent analysis  .....................  36 
Figure  6: ELISpot analysis  using splenocytes from animals treated with BNT162a1, 
BNT162b1, BNT162b2 or BNT162c2  ................................ ................................ .. 53 
Figure  7: Analysis of lymphocyte frequen cies in the blood of BNT162a1, 
BNT162b1, BNT162b2 or BNT162c2 vaccinated mice  ................................ ........  55 
Figure  8: Analysis of T cell activation in the blood of BNT162a1, BNT162b1, 
BNT162b2 or BNT162c2 vaccinated mice  ................................ ...........................  56 
Figure  9: Analysis of T cell counts in the dLNs of BNT162a1, BNT162b1, 
BNT162b2 or BNT162c2 vaccinated mice  ................................ ...........................  57 
Figure  10: Analysi s of B cell counts in the dLNs of BNT162a1, BNT162b1, 
BNT162b2 or BNT162c2 vaccinated mice  ................................ ...........................  57 
Figure  11: Analysis of T FH and B cell counts in the spleen of BNT162a1, BNT162b1, 
BNT162b2 or BNT162 c2 vaccinated mice  ................................ ...........................  58 
Figure  12: Quantification of cytokine secreting T cells upon S peptide restimulation 
in the spleen of BNT162a1, BNT162b1, BNT162b2 or BNT162c2 vaccinated 
mice  ................................ ................................ ................................ .....................  59 
Figure  13: Quantification of cytokine secretion upon S peptide restimulation of 
splenocytes of BNT162a1, BNT162b1, BNT162b2 or BNT162c2 vaccinated 
mice  ................................ ................................ ................................ .....................  61 
Figure  14: Cytotoxicity towards S protein expressing CT26 cells by CD8+ 
splenocytes from BNT162a1 or BNT162b1 vaccinated mice (mCorVAC#15).  .... 62 
Figure  15: Cytotoxicity towards S prot ein expressing CT26 cells by CD8+ 
splenocytes from BNT162b2 or BNT162c2 vaccinated mice (mCorVAC#16).  .... 63 
 
LIST OF TABLES  
Table  1: Changes and deviations to R&D study plan  ................................ ..........  15 
Table  2: Clinical stage SARS -CoV-2 vaccine candidates developed at 
BioNTech  ................................ ................................ ................................ .............  23 
Table  3: Materials  ................................ ................................ ................................  28 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709034
  
 
R&D Report R -20-0112  Version 01  Page 6 of 105 
  Strictly Confidential  
Table  4: Peptide pool for restimulation of splenocytes and dLN cells for ELISpot 
assays, flo w cytometry and cytokine multiplex assay  ................................ ..........  31 
Table  5: RNAs used for CT26 electroporation  ................................ .....................  32 
Table  6: Software  ................................ ................................ ................................  33 
Table  7: Mac hines  ................................ ................................ ...............................  33 
Table  8: Flow cytometry antibody master mixes for functional T cell analysis in the 
spleen and dLN (mCorVAC#15 and mCorVAC#1 6). ................................ ...........  40 
Table  9: Flow cytometry antibody master mixes for phenotypic T cell analysis in 
the spleen and dLN (mCorVAC#15 and mCorVAC#16) . ................................ ..... 42 
Table  10: Flow cytometry antibody master mixes for phenotypicT cell analysis in 
the blood (mCorVAC#15 and mCorVAC#16).  ................................ .....................  45 
Table  11: Flow cytometry antibody master mixes for B cell analysis in the spleen 
and dLN (mCorVAC#15 and mCorVAC#16). ................................ .......................  48 
Table  12: Flow cytometry antibody master mixes for myeloid cell analysis in the 
spleen (mCorVAC#15 and mCorVAC#16).  ................................ .........................  50 
Table  13: Statistical analyses  ................................ ................................ ..............  51 
Table  14: Parameters for experimental animal monitoring (single animal 
assessment)  ................................ ................................ ................................ ........  67 
Table  15: Record of body weights of mCorVAC#15 animals  during study  ..........  69 
Table  16: Record of animal monitoring during CorVac#15 study  .........................  70 
Table  17: Record of body weights of CorVac#16 animals during study  ...............  71 
Table  18: Record of animal monitoring during CorVac#16 study  .........................  72 
Table  19: ELISpot raw data.  ................................ ................................ ................  73 
Table  20: Detection ranges of the ProcartaPlex immunoassay for mCorVAC#15 
and mCorVAC#16.  ................................ ................................ ..............................  75 
Table  21: Cytokine raw data and calculated data for mCorVAC#15, part 1  of 6 (SP)
 ................................ ................................ ................................ ............................  76 
Table  22: Cytokine raw data and calculated data for mCorVAC#15, part 2 of 6 (SP)
 ................................ ................................ ................................ ............................  77 
Table  23: Cytokine raw data and calculated data for mCorVAC#15, part 3 of 6 (SP)
 ................................ ................................ ................................ ............................  78 
Table  24: Cytokine raw data and calculated data for mCorVAC#15, part 4 of 6 (SP)
 ................................ ................................ ................................ ............................  79 
Table  25: Cytokine raw data and calculated data for mCorVAC#15, part 5 of 6 (SP)
 ................................ ................................ ................................ ............................  80 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709035
  
 
R&D Report R -20-0112  Version 01  Page 7 of 105 
  Strictly Confidential  
Table  26: Cytokine raw d ata and calculated data for mCorVAC#15, part 6 of 6 (LN)
 ................................ ................................ ................................ ............................  81 
Table  27: Cytokine raw data and calculated data for mCorVAC#16, part 1 o f 6 (SP)
 ................................ ................................ ................................ ............................  82 
Table  28: Cytokine raw data and calculated data for mCorVAC#16, part 2 of 6 (SP)
 ................................ ................................ ................................ ............................  83 
Table  29: Cytokine raw data and calculated data for mCorVAC#16, part 3 of 6 (SP)
 ................................ ................................ ................................ ............................  84 
Table  30: Cytokine raw data and calculated data for mCorVAC#16, part 4 of 6 (SP)
 ................................ ................................ ................................ ............................  85 
Table  31: Cytokine raw data and calculated data for mCorVA C#16, part 5 of 6 (LN)
 ................................ ................................ ................................ ............................  86 
Table  32: Cytokine raw data and calculated data for mCorVAC#16, part 6 of 6 (LN)
 ................................ ................................ ................................ ............................  87 
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709036
  
 
R&D Report R -20-0112  Version 01  Page 8 of 105 
  Strictly Confidential  
LIST OF ABBREVIATION S 
Ab Antibody  
CP Cytoplasmic domain  
dLNs  Draining lymph nodes  
EDTA  Ethylenediaminetetraacetic acid  
FBS Fetal bovine serum  
FM Fluorescence minus  
FP Fusion peptide  
GC Germinal center  
HR1, 
HR2 Heptad repeats 1 and 2  
i.m. Intramuscular  
IFNγ  Interferon gamma  
Ig Immunoglobulin  
IL Interleukin  
IL Iliac 
IN Inguinal  
LD LiveDead viability dye  
LN Lymph node  
LNPs  Lipid nanoparticles  
Lot Lot number  
MM Master mix  
modRNA  Nucleoside modified mRNA  
NEAA  Non-essential amino acids  
PO Poplitea l 
RBD  Receptor binding domain  
RBM  Receptor binding motif  
S Spike protein  
saRNA  Self-amplifying RNA  
SP Signal peptide  
TFH Follicular helper T cells  
TH T helper cells  
TM Transmembrane domain  
TNF Tumor necrosis factor  
uRNA  Non-modified uridine -conta ining mRNA  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709037
         
    
  
   
 
 
 
  
     
 
 
 
 
 
   
    
               
              
              
    
        
              
      
            
  
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) 
(6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
FDA-CBER-2021-5683-0709038
  
 
R&D Report R -20-0112  Version 01  Page 10 of 105 
  Strictly Confidential  
1 SUMMA RY 
BioNTech is developing RNA -based vaccines designed to protect against the novel 
coronavirus disease that emerged in 2019 (COVID -19). The project involves testing 
three RNA platforms , which are under development at BioNTech , with the surface or 
spike (S) protein of the novel severe acute respiratory syndrome coronavirus 2 
(SARS -CoV-2) as the viral antigen.  
In the present study, T - and B -cell responses as well as the ability of CD8+ T cells to 
kill viral antigen -presenting cells induced by four clinical SA RS-CoV-2 vaccine 
candidates were characterized.  
The study was divided  into two parts , with the first part  characterizing the vaccine 
candidates BNT162a1  and BNT162b1 , and the second part characterizing  BNT162b2 
and BNT162c2. For each part, eight BALB/c mi ce per group were vaccinated with 5  µg 
of RNA encapsulated in lipid nanoparticles (LNPs) or buffer control on day  0 by 
intramuscular injection. T and B  cells were analyzed  seven days after vaccination in 
the blood. Serum  for optional determination of SARS -CoV-2 specific IgG responses  
was stored , spleen and the draining lymph nodes (dLNs) were analyzed  after 12 days 
(BNT162a1, BNT162b1 and BNT162b2 ), or 27 days (BNT162c2). Splenocytes were 
used for  IFNγ ELISpot assay  and xCELLigence cytotoxicity assay, and cell 
suspensions prepared from dLN s and spleen were  analyzed by flow cytometry . 
Cytokines produced by  restimulated dLN and spleen cells were analyzed by 
Procarta Plex cytokine multiplex assay .  
IFNγ  ELISpot revealed a strong S protein specific T -cell responses particularly in 
BNT162b2 , BNT162b1  and BNT162c2  and to a lesser extent in BNT162 a1 treated 
groups. In line, CD8+ and CD4+ T cells in dLNs were significantly increased after 
BNT162b2  treatment , the former already detectable at day 7 i n the blood . A trend for 
increased T cell numbers was detected in the BNT162b1  and BNT162 a1 groups.  
Particular BNT162b1 and BNT162b 2 treatment resulted in T cell activation (CD44, 
CD38, PD1 and ICOS expression of T c ells in blood) and antigen specific secretion  of 
cytokines by splenocytes . In those groups, a predominant T H1 phenotype was detected 
with increased numbers of T -bet+ CD4+ T cells, high secretion of T H1 type cytokines 
(IFNγ, IL -2, TNF) and low secretion of T H2 type cytokines (IL -4, IL-5). In all analyzed 
compartments  BNT162b 1, BNT162b 2 and BNT162c2  treatment mediated the increase 
and activation of  TFH cells, a cell type known for its crucial support of B cell responses. 
B cell numbers in dLNs were significantly elevated after BNT162b 1 and BNT162b 2 
treatment with higher numbers of antibody producing p lasma B cells, class switched 
and germinal center B cells  essential for affinity maturation of antibodies .  
Due to  the prominent  induction of  both T and B  cell responses , these results particularly 
support  further clinical evaluation of the S ARS-CoV-2 vaccine candidates BNT162b1 
and BNT162b2 .  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709039
 
         
 
   
    
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
FDA-CBER-2021-5683-0709040
  
 
R&D Report R -20-0112  Version 01  Page 12 of 105 
  Strictly Confidential  
2 GENERAL INFORMATION  
2.1 Sponsor and Test Facilities  
Sponsor  
BioNTech RNA Pharmaceuticals GmbH  
An der Goldgrube 12  
55131 Mainz  
Germany  
 
Test Facility  
BioNTech SE  
An der Goldgrube 12  
55131 Mainz  
Germany  
 
2.2 Participating Pers
Responsible p erson: 
(as defined in SOP -100-024) 
BioNTech RNA Pharmaceuticals GmbH  
An der Goldgrube 12  
55131 Mainz  
Author: 
BioNTech RNA Pharmaceuticals GmbH  
 
Experimenter:   
 
BioNTech RNA Pharmaceuticals GmbH  
 
Experimenter:   
 
BioNTech RNA Pharmaceuticals GmbH  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
FDA-CBER-2021-5683-0709041
  
 
R&D Report R -20-0112  Version 01  Page 13 of 105 
  Strictly Confidential  
Experimenter:   
 
BioNTech RNA Pharmaceuticals GmbH  
 
Experimenter:   
 
BioNTech RNA Pharmaceuticals GmbH  
 
Experimenter:   
  
BioNTech SE  
Experimenter:  
  
BioNTech SE  
Experimenter:  
  
BioNTech RNA Pharmaceuticals GmbH  
 
Experimenter:  
 h 
BioNTech RNA Pharmaceuticals GmbH  
 
Experimenter:  
 
BioNTech RNA Pharmaceuticals GmbH  
 
Experimenter:  
 
BioNTech RNA Pharmaceuticals GmbH  
 
 
2.3 Study Dates  
Start of experiments:   06 MAY  2020  
Completion of experiments:  04 JUN 2020  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
(b) (6)
FDA-CBER-2021-5683-0709042
  
 
R&D Report R -20-0112  Version 01  Page 14 of 105 
  Strictly Confidential  
2.4 Guidelines and Regulations  
All experiments are executed in accordance with the existing standard operating 
procedures and described processes from BioNTech  SE. Applicable documents are 
listed below.  
 Animal test application approval number: G18 -12-100, Amendme nt from 
24.04.2020 (approved 30.04.2020).  
 SOP -010-015 Pipetten und Dispenser  
 SOP -010-017 Brutschränke - Biolytics  
 SOP -010-028 Vi -Cell XR  
 SOP -010-045 Brutschrank HERAcell 150i  
 SOP -010-047 Zentrifuge Eppendorf 5810/5810R  
 SOP -010-051 Tiefkühlschränke -80°C 
 SOP-010-058 Sicherheitswerkbank Klasse II  
 SOP -010-086 Zentrifuge Thermo Scientific Heraeus Pico und Fresco 17  
 SOP -010-099 CTL ELISPOT Reader  
 SOP -010-128 FACSCelesta  
 SOP -020-009 Ansetzen von Medien und Zusätzen für die Zellkultur  
 SOP -030-038 Standardisierte K ultivierung von Zellen  
 SOP -030-041 Auftauen von Zellen  
 SOP -030-050 Elektroporation von Zellen  
 SOP -030-051 Selektion mit MACS MicroBeads  
 SOP -030-054 Extrazelluläre Färbung für Durchflusszytometrie  
 SOP -030-071 Abtöten von Mäusen  
 SOP -030-072 Fixiergriff und O hrmarkierung bei Mäusen  
 SOP -030-073 Betäubung bei Mäusen  
 SOP -030-074 Blutentnahme bei Mäusen  
 SOP -030-078 Isolierung muriner Splenozyten  
 SOP -030-079 Intramuskuläre Applikation bei Mäusen  
 SOP -030-110 IFN γ ELISpot (murin)  
 SOP -090-013 Biological safety in labo ratories  
 SOP -110-022 Entsorgung von Biostoffabfällen  
2.5 Changes and Deviations  
This R&D study was conducted according to R&D plan P-20-0112 . Table  1 
summarizes all changes and deviations to the R&D plan.  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709043
  
 
R&D Report R -20-0112  Version 01  Page 15 of 105 
  Strictly Confidential  
Table 1: Changes and deviations to R&D study plan  
Experiment  Assay Plan Change/Deviation  Reason for 
change/deviation  Implications  
mCorVAC#15  xCELLigen
ce 
cytotoxicity 
assay  Duplicates for all 
samples  Duplicates only for some 
samples  Not enough ce lls per 
mouse  Some samples were 
assayed in 
singlicates  
mCorVAC#15  Flow 
cytometry  Functional and 
phenotypic T 
cell analysis, 
dLN: 2  × 106 
cells/well  Functional and phenotypic T cell 
analysis, dLN: 1  × 106 cells/well  Not enough cells per 
mouse  Lower sample 
numbers for this 
assay  
mCorVAC#15  Flow 
cytometry  Phenotypic T 
cell analysis, 
SP: 2  × 106/well Phenotypic T cell analysis, SP: 
4 × 106/well Improve the quality of 
the results  None.  
mCorVAC#15  Flow 
cytometry  B cell analysis, 
dLN, SP: 
2 × 106/well   B cel l analysis, dLN: 
2.5 × 105/well. SP: 1  × 106/well     Not enough cells per 
mouse  Lower sample 
numbers for this 
assay  
mCorVAC#15  Flow 
cytometry  Phenotypic T 
cell analysis, 
SP: Use cells in 
200 µL for 
acquisition  Phenotypic T cell analysis, SP: 
Group 1 mous e 1: 160 µL 
sample acquired by device 
without recording. To the 
remaining sample volume, 160 
µL flow buffer were then added 
and the sample re -acquired and 
recorded.  Deviation  Total recordable 
living cell number for 
Group1 mouse 1 was 
133,209 instead of 
the intended 
minimum of 
1,000,000.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry  Analysis of SP 
and dLNs on 
day 12 (day 27)  Analysis of blood 7 days after 
immunization  Gain further information 
on the T and B cell 
immunophenotype 
early after immunization  Blood  phe notyping 
data available for 7 
days after 
immunization.  
mCorVAC#15, 
mCorVAC#16  ELISpot  Use 
MultiScreenHTS 
plates (Millipore)  Precoated ELISpot plates were 
used (Mabtech)  bring in line with 
previous mCorVac 
experiments  None.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry, 
cytokine 
multiplex 
assay  Restimulation 
with S peptide 
mixes at 0.1 
µg/mL per 
peptide  Restimulation with S peptide 
mixes at 0.2 µg/mL per peptide 
(mCorVAC#15 and 
mCorVAC#16) and at 0.5  µg/mL 
per peptide (flow cytometry, 
mCorVAC#16)  Increase peptide  
concentration to 
increase sensitivity and 
pick up low responses  Direct quantitative 
comparison of 
cytokine profiles 
derived from 
multiplex assay of 
mCorVac#15 
(BNT162a1 and 
BNT162b1) and 
mCorVac#16 
(BNT162b2 and 
BNT162c2) no longer 
advisable  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry 
(functional 
T cell 
analysis), 
cytokine dLN: All 
samples  dLN: Not all samples included in 
assay  Not enough cells per 
mouse  Lower sample 
numbers for this 
assay  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709044
  
 
R&D Report R -20-0112  Version 01  Page 16 of 105 
  Strictly Confidential  
Experiment  Assay Plan Change/Deviation  Reason for 
change/deviation  Implications  
multiplex 
analysis  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry  Brefeldin A an d 
GolgiStop in 
medium were 
added to a final  
concentration of 
10 μg/mL 
brefeldin A and 
a dilution of 
GolgiStop of 
1:500.  GolgiStop and GolgiPlug in 
medium were added to a final 
dilution of GolgiStop of 1:1,500 
and GolgiPlug of 1:1,000.  GolgiPlug contains 
brefeldin A and 
replaced brefeldin A 
solution. Dilution of 
GolgiStop was lowered 
as this lower dilution 
was found to be 
sufficient for its 
purpose.  None.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry  Extracellular and 
intracellular/intra
nuclear staining 
for phenot ypic 
and functional T 
cell analysis was 
performed alike 
and was the 
same for 
mCorVAC#15 
and 
mCorVAC#16.  
 
B and myeloid 
cell staining was 
not described in 
detail.  Extracellular and 
intracellular/intranuclear staining 
for phenotypic and functional T 
cell ana lysis varied compared to 
the study plan and was again 
altered between mCorVAC#15 
and mCorVAC#16 with respect 
to antibody panels, washing 
procedures, fixation procedures 
and centrifugation conditions 
(see sections 4.5.11.2, 4.5.11.3 
and 4.5.11.4 for details ).  
 
B and myeloid cell staining was 
performed according to section 
4.5.11.5  and 4.5.11.6.  Improve the quality of 
the results.  
 
Detailed stianing 
protocol for B and 
myeloid cells.  Direct quantitative 
comparison of T and 
B cell flow cytometry 
data of mCorV ac#15 
(BNT162a1 and 
BNT162b1) and 
mCorVac#16 
(BNT162b2 and 
BNT162c2) no longer 
advisable.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry 
(myeloid 
cell 
analysis)  dLN: All 
samples  dLN: No samples included in 
assay  Not enough cells per 
mouse  Assay was not 
performed for dLN  
mCorVAC#15, 
mCorVAC#16  Cytokine 
multiplex 
assay  dLN: 
5 × 105/well   dLN: 4  × 105/well   Not enough cells per 
mouse  Lower sample 
numbers for this 
assay  
mCorVAC#16  Flow 
cytometry  Phenotypic T 
cell analysis, 
dLN: 2  × 106 
cells/well.  Phenotypic T ce ll analysis, dLN: 
1.5 × 106 cells/well  Not enough cells per 
mouse.  Lower sample 
numbers for this 
assay  
mCorVAC#16  Flow 
cytometry  Phenotypic T 
cell analysis, 
SP: 2  × 106/well Phenotypic T cell analysis, SP: 
4 × 106/well Improve the quality of 
the results.  None.  
mCorVAC#16  Flow 
cytometry  B cell analysis, 
dLN, SP: 
2 × 106/well   B cell analysis, dLN: 
2.5 × 105/well. SP: 1  × 106/well     Not enough cells per 
mouse.  Lower sample 
numbers for this 
assay  
mCorVAC#16  xCELLigen
ce 
cytotoxicity 
assay  Using CT26 
cells 
electroporated S RNA electroporated CT26 
cells were loaded with S peptide 
mix after electroporation  Improve the quality of 
the results  None.  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709045
  
 
R&D Report R -20-0112  Version 01  Page 17 of 105 
  Strictly Confidential  
Experiment  Assay Plan Change/Deviation  Reason for 
change/deviation  Implications  
with S RNA as 
targets  
mCorVAC#15  xCELLigen
ce 
cytotoxicity 
assay  Duplicates for all 
samples  Duplicates only for  some 
samples  Not enough cells per 
mouse  Some samples were 
assayed in 
singlicates  
mCorVAC#15  Flow 
cytometry  Functional and 
phenotypic T 
cell analysis, 
dLN: 2  × 106 
cells/well  Functional and phenotypic T cell 
analysis, dLN: 1  × 106 cells/well  Not enough ce lls per 
mouse  Lower sample 
numbers for this 
assay  
mCorVAC#15  Flow 
cytometry  Phenotypic T 
cell analysis, 
SP: 2  × 106/well Phenotypic T cell analysis, SP: 
4 × 106/well Improve the quality of 
the results  None.  
mCorVAC#15  Flow 
cytometry  B cell analysis, 
dLN, SP: 
2 × 106/well   B cell analysis, dLN: 
2.5 × 105/well. SP: 1  × 106/well     Not enough cells per 
mouse  Lower sample 
numbers for this 
assay  
mCorVAC#15  Flow 
cytometry  Phenotypic T 
cell analysis, 
SP: Use cells in 
200 µL for 
acquisition  Phenotypic T cell  analysis, SP: 
Group 1 mouse 1: 160 µL 
sample acquired by device 
without recording. To the 
remaining sample volume, 160 
µL flow buffer were then added 
and the sample re -acquired and 
recorded.  Deviation  Total recordable 
living cell number for 
Group1 mouse 1 was 
133,209 instead of 
the intended 
minimum of 
1,000,000.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry  Analysis of SP 
and dLNs on 
day 12 (day 27)  Analysis of blood 7 days after 
immunization  Gain further information 
on the T and B cell 
immunophenotype 
early af ter immunization  Blood  phenotyping 
data available for 7 
days after 
immunization.  
mCorVAC#15, 
mCorVAC#16  ELISpot  Use 
MultiScreenHTS 
plates (Millipore)  Precoated ELISpot plates were 
used (Mabtech)  bring in line with 
previous mCorVac 
experiments  None.  
mCo rVAC#15, 
mCorVAC#16  Flow 
cytometry, 
cytokine 
multiplex 
assay  Restimulation 
with S peptide 
mixes at 0.1 
µg/mL per 
peptide  Restimulation with S peptide 
mixes at 0.2 µg/mL per peptide 
(mCorVAC#15 and 
mCorVAC#16) and at 0.5  µg/mL 
per peptide (flow cytometry, 
mCorVAC#16)  Increase peptide 
concentration to 
increase sensitivity and 
pick up low responses  Direct quantitative 
comparison of 
cytokine profiles 
derived from 
multiplex assay of 
mCorVac#15 
(BNT162a1 and 
BNT162b1) and 
mCorVac#16 
(BNT162b2 and 
BNT162c2) no lon ger 
advisable  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry 
(functional 
T cell 
analysis), 
cytokine dLN: All 
samples  dLN: Not all samples included in 
assay  Not enough cells per 
mouse  Lower sample 
numbers for this 
assay  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709046
  
 
R&D Report R -20-0112  Version 01  Page 18 of 105 
  Strictly Confidential  
Experiment  Assay Plan Change/Deviation  Reason for 
change/deviation  Implications  
multiplex 
analysis  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry  Brefeldin A and 
GolgiStop in 
medium were 
added to a final  
concentration of 
10 μg/mL 
brefeldin A and 
a dilution of 
GolgiStop of 
1:500.  GolgiStop and GolgiPlug in 
medium were added to a final 
dilution of GolgiStop of 1:1,500 
and GolgiPlug of 1:1 ,000.  GolgiPlug contains 
brefeldin A and 
replaced brefeldin A 
solution. Dilution of 
GolgiStop was lowered 
as this lower dilution 
was found to be 
sufficient for its 
purpose.  None.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry  Extracellular and 
intracellular/intra
nuclear staining 
for phenotypic 
and functional T 
cell analysis was 
performed alike 
and was the 
same for 
mCorVAC#15 
and 
mCorVAC#16.  
 
B and myeloid 
cell staining was 
not described in 
detail.  Extracellular and 
intracellular/intranuclear staining 
for phenotypi c and functional T 
cell analysis varied compared to 
the study plan and was again 
altered between mCorVAC#15 
and mCorVAC#16 with respect 
to antibody panels, washing 
procedures, fixation procedures 
and centrifugation conditions 
(see sections 4.5.11.2, 4.5.11 .3 
and 4.5.11.4 for details).  
 
B and myeloid cell staining was 
performed according to section 
4.5.11.5  and 4.5.11.6.  Improve the quality of 
the results.  
 
Detailed stianing 
protocol for B and 
myeloid cells.  Direct quantitative 
comparison of T and 
B cell f low cytometry 
data of mCorVac#15 
(BNT162a1 and 
BNT162b1) and 
mCorVac#16 
(BNT162b2 and 
BNT162c2) no longer 
advisable.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry 
(myeloid 
cell 
analysis)  dLN: All 
samples  dLN: No samples included in 
assay  Not enough cells per 
mouse Assay was not 
performed for dLN  
mCorVAC#15, 
mCorVAC#16  Cytokine 
multiplex 
assay  dLN: 
5 × 105/well   dLN: 4  × 105/well   Not enough cells per 
mouse  Lower sample 
numbers for this 
assay  
mCorVAC#16  Flow 
cytometry  Phenotypic T 
cell analysis, 
dLN: 2  × 106 
cells/well.  Phenotypic T cell analysis, dLN: 
1.5 × 106 cells/well  Not enough cells per 
mouse.  Lower sample 
numbers for this 
assay  
mCorVAC#16  Flow 
cytometry  Phenotypic T 
cell analysis, 
SP: 2  × 106/well Phenotypic T cell analysis, SP: 
4 × 106/well Improve t he quality of 
the results.  None.  
mCorVAC#16  Flow 
cytometry  B cell analysis, 
dLN, SP: 
2 × 106/well   B cell analysis, dLN: 
2.5 × 105/well. SP: 1  × 106/well     Not enough cells per 
mouse.  Lower sample 
numbers for this 
assay  
mCorVAC#16  xCELLigen
ce 
cytotox icity 
assay  Using CT26 
cells 
electroporated S RNA electroporated CT26 
cells were loaded with S peptide 
mix after electroporation  Improve the quality of 
the results  None.  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709047
  
 
R&D Report R -20-0112  Version 01  Page 19 of 105 
  Strictly Confidential  
Experiment  Assay Plan Change/Deviation  Reason for 
change/deviation  Implications  
with S RNA as 
targets  
Experiment  Assay  Plan  Change/Deviation  Reason for 
change/devi ation  Implications  
mCorVAC#15  xCELLigen
ce 
cytotoxicity 
assay  Duplicates for all 
samples  Duplicates only for some 
samples  Not enough cells per 
mouse  Some samples were 
assayed in 
singlicates  
mCorVAC#15  Flow 
cytometry  Functional and 
phenotypic T 
cell analys is, 
dLN: 2  × 106 
cells/well  Functional and phenotypic T cell 
analysis, dLN: 1  × 106 cells/well  Not enough cells per 
mouse  Lower sample 
numbers for this 
assay  
mCorVAC#15  Flow 
cytometry  Phenotypic T 
cell analysis, 
SP: 2  × 106/well Phenotypic T cell analysis , SP: 
4 × 106/well Improve the quality of 
the results  None.  
mCorVAC#15  Flow 
cytometry  B cell analysis, 
dLN, SP: 
2 × 106/well   B cell analysis, dLN: 
2.5 × 105/well. SP: 1  × 106/well     Not enough cells per 
mouse  Lower sample 
numbers for this 
assay  
mCo rVAC#15  Flow 
cytometry  Phenotypic T 
cell analysis, 
SP: Use cells in 
200 µL for 
acquisition  Phenotypic T cell analysis, SP: 
Group 1 mouse 1: 160 µL 
sample acquired by device 
without recording. To the 
remaining sample volume, 160 
µL flow buffer were then add ed 
and the sample re -acquired and 
recorded.  Deviation  Total recordable 
living cell number for 
Group1 mouse 1 was 
133,209 instead of 
the intended 
minimum of 
1,000,000.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry  Analysis of SP 
and dLNs on 
day 12 (day 27)  Analy sis of blood 7 days after 
immunization  Gain further information 
on the T and B cell 
immunophenotype 
early after immunization  Blood  phenotyping 
data available for 7 
days after 
immunization.  
mCorVAC#15, 
mCorVAC#16  ELISpot  Use 
MultiScreenHTS 
plates (Millipo re) Precoated ELISpot plates were 
used (Mabtech)  bring in line with 
previous mCorVac 
experiments  None.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry, 
cytokine 
multiplex 
assay  Restimulation 
with S peptide 
mixes at 0.1 
µg/mL per 
peptide  Restimulation with S peptid e 
mixes at 0.2 µg/mL per peptide 
(mCorVAC#15 and 
mCorVAC#16) and at 0.5  µg/mL 
per peptide (flow cytometry, 
mCorVAC#16)  Increase peptide 
concentration to 
increase sensitivity and 
pick up low responses  Direct quantitative 
comparison of 
cytokine profiles 
derived from 
multiplex assay of 
mCorVac#15 
(BNT162a1 and 
BNT162b1) and 
mCorVac#16 
(BNT162b2 and 
BNT162c2) no longer 
advisable  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry 
(functional dLN: All 
samples  dLN: Not all samples  included in 
assay  Not enough cells per 
mouse  Lower sample 
numbers for this 
assay  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709048
  
 
R&D Report R -20-0112  Version 01  Page 20 of 105 
  Strictly Confidential  
Experiment  Assay Plan Change/Deviation  Reason for 
change/deviation  Implications  
T cell 
analysis), 
cytokine 
multiplex 
analysis  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry  Brefeldin A and 
GolgiStop in 
medium were 
added to a final  
concentration of 
10 μg/mL 
brefeldin A and 
a dilution of 
GolgiStop of 
1:500.  GolgiStop and GolgiPlug in 
medium were added to a final 
dilution of GolgiStop of 1:1,500 
and GolgiPlug of 1:1,000.  GolgiPlug contains 
brefeldin A and 
replaced brefeldin A 
solution. Dilution of 
GolgiStop was lowered 
as this lower dilution 
was found to be 
sufficient for its 
purpose.  None.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry  Extracellular and 
intracellular/intra
nuclear staining 
for phenotypic 
and functional T 
cell analysis was 
performed alike 
and was the 
same for 
mCorVAC#15 
and 
mCorVAC#16.  
 
B and myeloid 
cell staining was 
not described in 
detail.  Extracellular and 
intracellular/intranuclear staining 
for phenotypic and functional T 
cell analysis varied compared to 
the study plan and was again 
altered between mCorVAC#15 
and mCorVAC#16 with respect 
to antibody panels, washing 
procedures, fixation procedures 
and centrifugation conditions 
(see sections 4.5.11.2, 4.5.11.3 
and 4.5.11.4 for details).  
 
B and myeloid cell staining was 
performed according to section 
4.5.11.5  and 4.5.11.6.  Improve the quality of 
the res ults. 
 
Detailed stianing 
protocol for B and 
myeloid cells.  Direct quantitative 
comparison of T and 
B cell flow cytometry 
data of mCorVac#15 
(BNT162a1 and 
BNT162b1) and 
mCorVac#16 
(BNT162b2 and 
BNT162c2) no longer 
advisable.  
mCorVAC#15, 
mCorVAC#16  Flow 
cytometry 
(myeloid 
cell 
analysis)  dLN: All 
samples  dLN: No samples included in 
assay  Not enough cells per 
mouse  Assay was not 
performed for dLN  
mCorVAC#15, 
mCorVAC#16  Cytokine 
multiplex 
assay  dLN: 
5 × 105/well   dLN: 4  × 105/well   Not enough cells per 
mouse Lower sample 
numbers for this 
assay  
2.6 Documentation and Archive  
Study plans and reports are stored and archived according to SOP -100-003 Archiving 
of Paper -Based Documents.  
Raw data and evaluated data are saved at : 
 P:\BioNTechRNA \RN9391R00_CoV -
VAC\04_Pr eclinic \00_Pharmacology \mCorVac#15_modRNA_uRNA_V5_dLN
_SP 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709049
  
 
R&D Report R -20-0112  Version 01  Page 21 of 105 
  Strictly Confidential  
 P:\BioNTechRNA \RN9391R00_CoV -
VAC\04_Preclinic \00_Pharmacology \mCorVac#16_saRNAV9_modRNAV9_d
LN_SP  
 Lab book #1934, page 16-80   
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709050
  
 
R&D Report R -20-0112  Version 01  Page 22 of 105 
  Strictly Confidential  
3 INTRODUCTION  
3.1 Background  
In December 2019, an outbreak of pneumonia of unk nown cause in Wuhan, Hubei 
province in China , started. The disease sprea d rapidly and in January 2020, the agent 
was identified. By July 27th 2020, infection with the novel Coronavirus SARS -CoV-2 
was confirmed in approximately 16,100, 000 people with more t han 640,000 
casualties1. A vaccine  is urgently needed against the elicited coronavirus disease 19 
(COVID -19) and B ioNTech  decided to initiate  a rapid vaccine project based on the 
surface or spike (S) protein of the virus as the viral antigen. The S p rotein  is a trimer 
and during viral egress, the precursor protein is cleaved in to S1 an d S2 ( Figure  1). 
While the S1 domain recognizes the host receptor, the S2 domain is essential for 
membrane fusion of the viral envelop e and the endosomal membrane. To initiate 
membrane fusion, the S2 domain undergoes a conformational change within the 
central helix domain.  
 
Figure 1: Schematic overview of the S protein  structure  of the SARS -CoV S protein  
The se quence within the S1 subunit consists of the signal peptide (SP) and the receptor binding domain (RBD) with 
its receptor binding motif (RBM). The S2 subunit contains the fusion peptide (FP) for membrane fusion, heptad 
repeats (HR1 and HR2 ), the transmembra ne domain (TM) and a cytoplasmic domain (CP) . Source: modified from  
Song et al. 2019 .  
Based on these features, the S protein is the target of neutralizing antibodies that bind  
predominantly the receptor -binding domain (RBD) of  the S protein.  
The development of in vitro  transcribed RNA as an active platform for the use in 
infectious disease vaccines is based on the extensive knowledge of the company in 
RNA technology, which has been gained over the last decade.  The core innovati on is 
based on in vivo  delivery of a pharmacologically optimized, antigen -coding RNA 
vaccine to induce robust neutralizing antibodies and concomitant T -cell response s to 
achieve protective immunization with minimal vaccine doses  (Vogel et al. 2018 , Pardi 
et al. 2017 , Moyo et al. 2019 ).  
At BioNTech, there are three different RNA platforms under development, which are  
non-modified uridine containing mRNA (uRNA), nucleosi de modified mRNA 
(modRNA) and self -amplifying RNA (saRNA). It is unknown today which RNA vaccine 
                                            
1 Coronavirus diseas e (COVID -2019) situation report 189, World Health Organization;  
https://www.who.int/emergencies/diseases/novel -coronavirus -2019/situation -reports  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709051
  
 
R&D Report R -20-0112  Version 01  Page 23 of 105 
  Strictly Confidential  
platform performs best in terms of activation and duration of a potent immune 
response. Initial studies in mice demonstrated the induction of T -cell responses as well 
as SARS -CoV-2-specific (neutralizing) IgG antibodies with vaccine candidates o f all 
platforms. Four of th ese candidates are currently tested in clinica l trials ( Table  2). 
The BNT162 vaccine candidate RNA is encapsulated into lipid n anoparticle s (LNPs), 
which protect the RNA from degradation and enable transfectio n of host cells after 
intramuscular  (i.m.) injection. For all of the BNT162 vaccine candidates , the same LNP 
formulation is used.   
Table 2: Clinical stage SARS-CoV-2 vaccine candidates developed at BioNTech  
ID RNA platform  Antigen 
BNT162a1  uRNA  RBD of S1S2 protein (V5)  
BNT162b1  modRNA  RBD of S1S2 protein (V5)  
BNT162b2  modRNA  S1S2 full -length protein, sequence variant (V9)  
BNT162c2  saRNA  S1S2 full -length protein, sequence variant (V9)  
This report covers a mouse study characterizing  the immunophenotype in the blood, 
spleen and lymph node s of mice treated with these four SARS -CoV-2 vaccine 
candidates.  
3.2 Objectives  
The objective o f this study was to further characterize the four clinical SARS -CoV-2 
vaccine candidates to support fast clinical development and approval. In particular, the 
goal of this study was to: 
 Characterize T - and B -cell responses in the spleen , lymph nodes  and bl ood. 
Analysis include d a thorough phenotypic and functional (cytokine secretion on 
the cellular level) characterization of cells  by ELISPot and flow cytometry , and 
defin ition of  the cytokine  profile  by multiplex protein quantitation. In particular, 
the sub type of SARS -CoV-2-specific CD4+ T cells ( TH1, T H2, T FH) and the 
abundance of plasma and germinal center (GC) B cells were  of interest. 
Characterize changes in the myeloid cell compartment.  
 Determine  the ability of CD8+ T cells to kill cells  presenting th e vaccine -
encoded antigen .  
 Collect serum of mice to determine (ne utralizing) antibody responses 
(collection was performed, analysis of samples may be performed  in the future , 
if required) . 
3.3 Study Design  
The study was separated into two parts characterizing  the vaccine candidates 
BNT162a1  and BNT162b1 (mCorVac#15, Figure  2) and BNT162b2 and BNT162c2 
(mCorVac#16, Figure  3). Each part compare d the effects of vaccinated mice to a 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709052
  
 
R&D Report R -20-0112  Version 01  Page 24 of 105 
  Strictly Confidential  
control group receiving buffer only. Eight BALB/c mice per group were  vaccinated once 
(day 0) and blood analyzed 7 days later. S erum and tissues  were  analyzed  12 days 
later. Since T -cell responses of mice vaccinated with saRNA (BNT162c2) take longer 
to dev elop, the analysis time point for serum and tissues was postponed to day 27 after 
vaccination.  
Blood, spleen and draining lymph nodes (dLNs) were harvested from mice. Figure  4 
shows an overview of the  subsequent  analytical methods  including sample allocation 
to the respective assays .  
 Serum was obtained from blood and stored frozen for optional determination of 
SARS -CoV-2 specific IgG responses.  
 Splenocytes were  tested for recognition of an S protein -specific peptid e mix or 
S RNA -electroporated CT26 cells  by secretion of IFNγ  (IFNγ ELISpot assay ). 
 A fraction of splenocytes (N=3 only for the control group, N=8 for treatment 
groups) was restimulated overnight with an S protein -specific peptide mix and 
recombinant IL -2, and isolated CD8+ T cells were  challenged on the next day 
for killing of S RNA -electroporated CT26 colon carcinoma cells (xCELLigence 
cytotoxicity assay).  
 Splenocytes and  dLN (popliteal, iliac and inguinal, pooled)  cells were  analyzed 
for T- (CD4+ TH1, T H2, T FH, CD8+ T cells) and B -cell phenotype (GC, plasma, 
memory B cells),  T-cell cytokine secretion after restimulation with an S protein -
specific peptide mix , and myeloid cell subsets  (flow cytometry ).  
 dLN and spleen cells were  restimulated for 48  h with an S protein -specific 
peptide mix to analyze T-cell secreted cytokines in the supernatant  
(ProcartaPlex cytokine multiplex assay) . 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709053
  
 
R&D Report R -20-0112  Version 01  Page 25 of 105 
  Strictly Confidential  
  
Figure 2: Workflow of part 1 of the study (mCorVac#15)  
dLN, draining lymph node. GC, germinal cen ter. Gr, group. N, number of mice per group. TH, T helper cells. T FH, 
follicular T helper cells.  
 
Figure 3: Workflow of part  2 of the study (mCorVac#16)  
Study dates for group 3 are depicted in red. dLN, draining lymph node. GC, g erminal center.  Gr, group. N, number 
of mice per group. TH, T helper cells. T FH, follicular T helper cells.  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709054
  
 
R&D Report R -20-0112  Version 01  Page 26 of 105 
  Strictly Confidential  
 
Figure 4: Analysis and assay overview  
Schematic depiction of sample allocation to different analysis methods and their timing during analysis days 1 to 3 . 
dLN, draining lymph node. EP, electroporated.  
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709055
  
 
R&D Report R -20-0112  Version 01  Page 27 of 105 
  Strictly Confidential  
4 MATERIALS AND METHOD S 
4.1 Test Item  
BNT162a1  (ATM): For CoAs see Appendix  9.6 
 RNA batch: RNA -SK200305 -01 
 Polymun batch RBL063.3 LNP  with the lot: CoVVAC/090320  
 Dilution buffer: 0.9% NaCl  
 Concentration: 0.5 mg/mL  
BNT162b 1 (ATM): For CoAs see  Appendix  9.6.  
 RNA batch: RN A-RF200304 -03 
 Polymun batch RBP020.3 LNP with the lot: CoVVAC/100320  
 Dilution buffer: 0.9% NaCl  
 Concentration: 0.5 mg/mL  
BNT162b2  (ATM): For CoAs see Appendix  9.8.  
 RNA batch: RNA -RF200321 -06 
 Polymun batch RBP20.2 LNP with the lot: CoVVAC/270320  
 Dilution buffer: 0.9% NaCl  
 Concentration : 0.5 mg/mL  
BNT162c2 (ATM): For CoAs see  Appendix  9.9.  
 RNA batch: RNA -RF200310 -01 
 Polymun batch RBS004.2 LNP with the lot: CoVVAC/170320  
 Dilution buffer: 0.9% NaCl  
 Concentration: 0.3 mg/mL  
Test items are diluted  to 0.25 mg/mL with sterile 0.9% NaCl before administration.  
4.2 Control Item  
 0.9% NaCl  
4.3 Test System  
 48 female BALB /c mice with approximately nine weeks of age at study start  
4.4 Materials  
For antibodies used in flow cytometry, refer to  Section  4.5.11 .  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709056
  
 
R&D Report R -20-0112  Version 01  Page 28 of 105 
  Strictly Confidential  
Table 3: Materials  
Product name  Application/specific
ation Article no.  Working 
dilution Provider  
15 mL/50 mL tube  Conical bottom, PP, 
30/115 MM,  
CELLSTAR®  188271/ 
227261  N/A Greiner Bio -One 
GmbH  
2 mL tube  CRYO.S, round 
bottom  122278  N/A Greiner Bio -One 
GmbH  
2-Mercaptoethanol  50 mM 31350 -010 N/A Gibco  
4mL Sample Cup  Cell counting  NC9756824  N/A Beckman Coulter 
GmbH  
8-channel manifold  Polypropylene  BR704526 -
1EA N/A Sigma -Aldrich 
Chemie GmbH  
96-well Microplate  Clear round bottom 
TC-treated 
microplate, with lid, 
sterile  3799  N/A Corning Holding 
GmbH  
ACK lysis buffer  Flow cytometry  
(blood)  A10492 -01 1x Gibco  
Ammonium chloride  NH 4Cl A0988,5000  N/A AppliChem GmbH  
Brilliant Stain Buffer  Flow cytometry  563794  N/A BD Bioscience  
Brilliant Stain Buffer Plus  Flow cytometry  566385  N/A BD Biosciences  
Capillary pipettes  minicaps®, blood 
sampling,  4 µL/ 
10 µL, not 
heparinized  9000104/  
9000110  N/A Hirschmann 
Laborgeräte 
GmbH & Co.KG  
Cell culture flask 250 ML, 
75 cm²  Cell culture  658175  N/A Greiner Bio -One 
GmbH  
CD8a (Ly -2) MicroBeads  CD8 T cell 
purification  130-117-044 N/A Miltenyi Biotec  
Collagenase D  Lymphnode 
preparation  1108886600
1 1 mg/ml  Merck KGaA  
Combitips advanced®  Biopur®, 50  mL 0030089693  N/A Eppend orf 
Vertrieb 
Deutschland 
GmbH  
Concanavalin A  from Canavalia 
ensiformis (Jack 
bean, 5mg),Type IV -
S, lyophilized  C0412 -5MG  2 µg/mL  Sigma -Aldrich 
Chemie GmbH  
Dimethyl sulfoxide  Cell culture  A3672,0100  N/A AppliChem GmbH  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709057
  
 
R&D Report R -20-0112  Version 01  Page 29 of 105 
  Strictly Confidential  
Product name  Application/specific
ation Article no.  Working 
dilution Provider  
DPBS  No calcium, no 
magnesium  14190 -094 1 × Thermo Fisher 
Scientific  
Easystrainer 70  µm For 50  mL tubes  542070  N/A Greiner Bio -One 
GmbH  
Electroporation cuvette  Electroporation  732-1137  N/A VWR 
International 
GmbH  
E-Plate VIEW 96 PET  xCelligence  300600910  N/A ACEA 
Biosciences  
Eppendorf saf e-lock tubes  0.5 mL/ 1.5  mL/ 
2.0 mL/ 5.0  mL, 
Eppendorf Quality™  0030121023/
0030120086/
0030120094/
0030119401  N/A Eppendorf 
Vertrieb 
Deutschland 
GmbH  
Ethylenediaminetetraacetic 
acid solution  EDTA  03690 -
100ML  N/A Sigma -Aldrich 
Chemie GmbH  
Fetal Bovine Serum  Non-USA origin, 
sterile -filtered  F7524  N/A Sigma -Aldrich 
Chemie GmbH  
Filtration unit for medium 
flasks  High Performance, 
PES, 0.45  µm, 
1000  mL 514-0301  N/A VWR 
International 
GmbH  
FoxP3/Transcription Factor 
Staining Buffer Set  Flow cytometry  00-5523 -00 N/A Thermo Fisher 
Scientific  
GolgiStop  Flow cytometry 
(Restimulation)  554724  1:1,500  BD Biosciences  
GolgiPlug  Flow cytometry 
(Restimulation)  555029  1:1,000  BD Biosciences  
Heparin Tubes  Flow cytometry 
(Blood ) 20.1309  N/A Sarstedt AG & 
Co. 
HEPES  1 M 15630 -056 N/A Gibco  
Insulin syringes  BD Micro -Fine™+, 
30 G, 0.3  mL 324826  N/A Becton Dickinson 
GmbH  
Ionomycin, 10  µg/µL  Flow cytometry 
(Restimulation)  I9657  1 µg/mL  Sigma  
Isoflurane  Anesthesia  9714675  N/A Piramal Critical 
Care  
Isotonic saline  Injection solu tion 06173569  N/A Fresenius Kabi 
Deutschland 
GmbH  
LS columns  CD8 T cell 
purification  130-042-401 N/A Miltenyi Biotec  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709058
  
 
R&D Report R -20-0112  Version 01  Page 30 of 105 
  Strictly Confidential  
Product name  Application/specific
ation Article no.  Working 
dilution Provider  
MEM Non -Essential Amino 
Acids Solution (100X)  Cell culture  11140 -035 1X Gibco  
Mouse IFN -γ ELISpotPLUS 
kit Kit for enumeration 
of cells secreting 
mouse IFN -γ 3321 -4APT -2 N/A Mabtech  
PBS dry substance  No calcium, no 
magnesium  L182 -10 N/A Merck KGaA  
Penicillin -Streptomycin  10,000  U/mL  15140 -122 N/A Gibco  
PepMix™ against RBD  ELISpot  N/A 
(customized)  0.0625mg 
per 
peptide/ 
vial JPT 
Pipette tips  ep Dualfilter 
T.I.P.S.®, PCR clean 
und sterile, 0.1 –
10 µL/2–100 µL/50 –
1000  µL/50 –
1250  µL/0.1 –5 mL 0030077512/
0030077547/
0030077555/
0030077792/
0030077750/
0030078616  N/A Eppendorf 
Vertrieb 
Deutsch land 
GmbH  
PMA, 1  µg/µL  Flow cytometry 
(Restimulation)  P1585  0.5 µg/mL  Sigma  
Potassium bicarbonate  KHCO 3 A2375,1000  N/A AppliChem GmbH  
ProcartaPlex  
mouse T H1/T H2 cytokine 
11-plex kit  Cytokine multiplex 
assay  
Lot. No. 232634 -004 EPX110 -
20820 -901 
 N/A Thermo Fisher 
Scientific  
Proleukin S  Cell culture  N/A 100 U/ml  Clinigen  
Reservoir  25 mL, 100 mL  613-
1174/613 -
1171  N/A VWR 
International 
GmbH  
RotiHistofix  Flow cytometry  P087.1  2% Roth  
Round bottom 5 -mL tubes  Flow cytometry 
(blood)  10579511  N/A Thermo Fishe r 
Scientific  
RPMI 1640 Medium  GlutaMAX™ 
Supplement  61870 -010 N/A Gibco  
Serological pipettes  5 mL, 10  mL, 25  mL, 
50 mL 606180/6071
80/601180/7
68180  N/A Greiner Bio -One 
GmbH  
Serum Tubes  Serum preparation  20.1344  N/A Sarstedt AG & 
Co. 
Single -use syringe  Injekt® Solo 5  mL 4606051V  N/A B. Braun 
Melsungen AG  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709059
  
 
R&D Report R -20-0112  Version 01  Page 31 of 105 
  Strictly Confidential  
Product name  Application/specific
ation Article no.  Working 
dilution Provider  
Sodium acide (10%)  Flow cytometry  
(blood)  13553.00100  0.01%  Morphisto  
Sodium Pyruvate  100 mM 11360 -039 N/A Gibco  
StemPro™ Accutase™ Cell 
dissociation reagent  Cell culture  A1110501  N/A Gibco  
Sterile fil ters 0.45 µm  514-4123  N/A VWR 
International  
Vi-CELL™ XR Quad Pak  For Vi -CELL™  XR 
Cell Viability 
Analyzer  383722  N/A Beckman Coulter 
GmbH  
X-VIVO 15, serum -free Electroporation  BE02 -060Q  N/A Lonza Group Ltd  
Table 4: Peptide pool fo r restimulation of splenocytes  and dLN cells for ELISpot assays , flow cytometry 
and cytokine multiplex assay  
S protein-specific peptides  
Name Sequence  
2019 -nCoV S.wt  
With a total of 315 
overlapping peptides 
(15mers overlapping by 
11 amino acids ) 
GenBank:  QHD43416.1  
 
Batch: 43000LHB -1 and 
43000LHB -2 
 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQ
DLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWI
FGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEF
RVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTP I
NLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAA
AYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTS
NFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLY
NSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYN
YKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFE RDISTEIYQA
GSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCG
PKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRD
PQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPT
WRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRA
RSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTIS VTTEILPVSMTKTSVDCT
MYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTP
PIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAA
RDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVN
QNAQALNTLVKQLSSNFGAISSVL NDILSRLDKVEAEVQIDRLITGRLQSLQTY
VTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHG
VVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVFVSNGTHWFVTQRNFYE
PQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVD
LGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLG
FIAGLIAIVMVTIM LCCMTSCCSCLKGCCSCGSCCKFDEDDSEPVLKGVKLHY
T 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709060
  
 
R&D Report R -20-0112  Version 01  Page 32 of 105 
  Strictly Confidential  
 
Table 5: RNAs used for CT26 electroporation  
Name Sequence (open reading frame)  
S RNA   
(Full construct 
name: 
JR206_mRNA_
pST4_m1ѱ_wts
ec_SARS -CoV-
2-S (Sino CDS) 
C∆19 ) atgtttgtgttcctggtgctgctg ccactggtgtccagccagtgtgtgaacctgaccaccaggacccaacttcctcctgcctaca
ccaactccttcaccaggggagtctactaccctgacaaggtgttcaggtcctctgtgctgcacagcacccaggacctgttcctg
ccattcttcagcaatgtgacctggttccatgccatccatgtgtctggcaccaatggcaccaagaggtttgacaaccctgtgctgc
cattcaatgatggagtctactttgcca gcacagagaagagcaacatcatcaggggctggatttttggcaccaccctggacag
caagacccagtccctgctgattgtgaacaatgccaccaatgtggtgattaaggtgtgtgagttccagttctgtaatgacccattc
ctgggagtctactaccacaagaacaacaagtcctggatggagtctgagttcagggtctactcctctgccaacaactgtaccttt
gaatatgtgagccaaccattcctgatggactt ggagggcaagcagggcaacttcaagaacctgagggagtttgtgttcaag
aacattgatggctacttcaagatttacagcaaacacacaccaatcaacctggtgagggacctgccacagggcttctctgcctt
ggaaccactggtggacctgccaattggcatcaacatcaccaggttccagaccctgctggctctgcacaggtcctacctgaca
cctggagactcctcctctggctggacagcaggagcagcagcc tactatgtgggctacctccaaccaaggaccttcctgctga
aatacaatgagaatggcaccatcacagatgctgtggactgtgccctggacccactgtctgagaccaagtgtaccctgaaatc
cttcacagtggagaagggcatctaccagaccagcaacttcagggtccaaccaacagagagcattgtgaggtttccaaacat
caccaacctgtgtccatttggagaggtgttcaatgccaccaggtttgcctctg tctatgcctggaacaggaagaggattagca
actgtgtggctgactactctgtgctctacaactctgcctccttcagcaccttcaagtgttatggagtgagcccaaccaaactgaa
tgacctgtgtttcaccaatgtctatgctgactcctttgtgattaggggagatgaggtgagacagattgcccctggacaaacagg
caagattgctgactacaactacaaactgcctgatgacttcacaggctgtgtgattgc ctggaacagcaacaacctggacagc
aaggtgggaggcaactacaactacctctacagactgttcaggaagagcaacctgaaaccatttgagagggacatcagca
cagagatttaccaggctggcagcacaccatgtaatggagtggagggcttcaactgttactttccactccaatcctatggcttcc
aaccaaccaatggagtgggctaccaaccatacagggtggtggtgctgtcctttgaactgctccatgcc cctgccacagtgtgt
ggaccaaagaagagcaccaacctggtgaagaacaagtgtgtgaacttcaacttcaatggactgacaggcacaggagtgc
tgacagagagcaacaagaagttcctgccattccaacagtttggcagggacattgctgacaccacagatgctgtgagggac
ccacagaccttggagattctggacatcacaccatgttcctttggaggagtgtctgtgattacacctggcaccaacaccagca a
ccaggtggctgtgctctaccaggatgtgaactgtactgaggtgcctgtggctatccatgctgaccaacttacaccaacctgga
gggtctacagcacaggcagcaatgtgttccagaccagggctggctgtctgattggagcagagcatgtgaacaactcctatg
agtgtgacatcccaattggagcaggcatctgtgcctcctaccagacccagaccaacagcccaaggagggcaaggtctgtg
gcaagccagag catcattgcctacacaatgagtctgggagcagagaactctgtggcttacagcaacaacagcattgccatc
ccaaccaacttcaccatctctgtgaccacagagattctgcctgtgagtatgaccaagacctctgtggactgtacaatgtatatct
gtggagacagcacagagtgtagcaacctgctgctccaatatggctccttctgtacccaacttaacagggctctgacaggcatt
gctgtggaacaggacaag aacacccaggaggtgtttgcccaggtgaagcagatttacaagacacctccaatcaaggactt
tggaggcttcaacttcagccagattctgcctgacccaagcaagccaagcaagaggtccttcattgaggacctgctgttcaac
aaggtgaccctggctgatgctggcttcatcaagcaatatggagactgtctgggagacattgctgccagggacctgatttgtgc
ccagaagttcaatggactgacagtgctgc ctccactgctgacagatgagatgattgcccaatacacctctgccctgctggctg
gcaccatcacctctggctggacctttggagcaggagcagccctccaaatcccatttgctatgcagatggcttacaggttcaat
ggcattggagtgacccagaatgtgctctatgagaaccagaaactgattgccaaccagttcaactctgccattggcaagattc
aggactccctgtccagcacagcctctgccctgggcaa actccaagatgtggtgaaccagaatgcccaggctctgaacacc
ctggtgaagcaactttccagcaactttggagccatctcctctgtgctgaatgacatcctgagcagactggacaaggtggaggc
tgaggtccagattgacagactgattacaggcagactccaatccctccaaacctatgtgacccaacaacttatcagggctgct
gagattagggcatctgccaacctggctgccaccaagatgagtgagtgt gtgctgggacaaagcaagagggtggacttctgt
ggcaagggctaccacctgatgagttttccacagtctgcccctcatggagtggtgttcctgcatgtgacctatgtgcctgcccag
gagaagaacttcaccacagcccctgccatctgccatgatggcaaggctcactttccaagggagggagtgtttgtgagcaatg
gcacccactggtttgtgacccagaggaacttctatgaaccacagattatcaccacag acaacacctttgtgtctggcaactgt
gatgtggtgattggcattgtgaacaacacagtctatgacccactccaacctgaactggactccttcaaggaggaactggaca
aatacttcaagaaccacaccagccctgatgtggacctgggagacatctctggcatcaatgcctctgtggtgaacatccagaa
ggagattgacagactgaatgaggtggctaagaacctgaatgagtccctgattgacctccaagaact gggcaaatatgaac
aatacatcaagtggccatggtacatctggctgggcttcattgctggactgattgccattgtgatggtgaccataatgctgtgttgta
tgacctcctgttgttcctgtctgaaaggctgttgttcctgtggctcctgttgttgatga  
Irrelevant RNA  
(Batch: RNA -
KG200106 -06c)  atgggcgccatggcccctagaacattgctcctgctgctggccgctgccctggc ccctacacagacaagagctggacctggc
ggctctggaggaggcggctccggaggcggaggatccggtggtggcggcagcggcggcgtgatcgtggctgtgctgggcg
tgctgggagccatggccatcattggagccgtggtggccttcgtgatgaagcggagaagaaacaccggcggcaagggcgg
cgattacgctctggctcctggcagccagtccagcgagatgagcctgagagactgcaaggcctagtaa  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709061
  
 
R&D Report R -20-0112  Version 01  Page 33 of 105 
  Strictly Confidential  
Table 6: Software   
Product name  Application  Provider  
BD FACSDiva software 
version 9.1 and 8.0.1.1  Flow cytometry  BD Biosciences  
 
Excel  Raw data  Microsoft Corp.  
FlowJo software version 
10.6 Flow cytometry  FlowJo LLC, BD 
Bioscience s 
 
GraphPad Prism software 
version 8  Statistical analysis  GraphPad Software Inc.  
ImmunoCapture 7.0.7.0  ELISpot assay  Cellular Technology Ltd  
ImmunoSpot® analysis 
software version 57.0.17.0  ELISpot assay  Cellular Technology Ltd  
ProcartaPley Analyst 
software version 1  Cytokine multiplex assay  Thermo Fisher Scientific  
RTCA Data analysis 
software  xCELLigence cytotoxicity assay  ACEA Biosciences  
xCELLigence RTCA 
Software Pro  xCELLigence cytotoxicity assay  ACEA Biosciences  
Table 7: Machines  
Product name  Application  Provider  
BD Symphony A3  Flow cytometry  BD Biosciences  
BD Celesta  Flow cytometry  BD Biosciences  
Bioplex200 s ystem  Cytokine multiplex assay  Bio-Rad 
Centrifuges  Centrifugation  Eppendorf  
CTL ELISPOT reader 
ImmunoSpot® S6 Core 
Analyzer  ELISpot assay  Cellular Technology 
Limited  
Electroporation system  Electroporation  BTX 
Vi-CELL XR  Cell counting  Beckman Coulter GmbH  
xCELLigence RTCA MP  xCELLigence cytotoxicity assay  ACEA Biosciences  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709062
  
 
R&D Report R -20-0112  Version 01  Page 34 of 105 
  Strictly Confidential  
4.5 Methods  
4.5.1 Animal Care  
4.5.1.1 General Informati on  
BALB/c mice were delivered at the age of at least six weeks. Delivered mice were used 
for experiments after approximately one week of acclimatization. All experiments and 
protocols were approved by the local authorities (local welfare committee), condu cted 
according to the FELASA recommendations and in compliance with the German 
animal welfare act and Directive 2010/63/EU. Only animals with an unobjectionable 
health status were selected for testing procedures.   
All animals were registered upon arrival in the lab animal colony management system 
PyRAT (Scionics Computer Innovation GmbH, Dresden, Germany) and tracked until 
death. Each cage was labelled with a cage card indicating the mouse strain, gender, 
date of birth and number of animals per cage. At th e start of an experiment additional 
information was added such as the project and license number, the start of the 
experiment and details on interventions. Where necessary for identification, animals 
were arbitrarily numbered with earmarks.  
4.5.1.2 Housing Conditi on and Husbandry  
Mice were housed at BioNTech SE's animal facility under barrier and SPF conditions 
(An der Goldgrube 12, 55131 Mainz) in individually ventilated cages (Sealsafe GM500 
IVC Green Line, TECNIPLAST, Hohenpeißenberg, Germany; 500 cm²) with a 
maximum of five animals per cage. The temperature and relative humidity in the cages 
and animal unit was kept at 20 -24°C and 45 -55%, respectively, and the air change 
(AC) rate in the cages at 75 AC/h. The cages with dust -free bedding made of debarked 
choppe d aspen wood (Abedd LAB & VET Service GmbH, Vienna, Austria, product 
code: LTE E -001) and additional nesting material were changed weekly. Autoclaved 
ssniff M -Z food (sniff Spezialdiäten GmbH, Soest, Germany; product code: V1124) and 
autoclaved water (tap water) were provided ad libitum  and changed at least once 
weekly. All materials were autoclaved prior to use.  
4.5.2 Animal Monitoring  
Routine animal monitoring was carried out daily and included inspection for dead 
animals and control of food and water supplies.  Each animal's health was closely 
assessed at least once weekly and the results documented in health monitoring 
sheets. The general physical condition was assessed with regard to the following 
parameters:  
 Body weight change  
 Macroscopic assessment of activi ty level/ behavior  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709063
  
 
R&D Report R -20-0112  Version 01  Page 35 of 105 
  Strictly Confidential  
 Macroscopic assessment of general discomfort: drop in body temperature 
determined by touch and by visual inspection of ears and paws. Ears and paws 
appear pink in a healthy mouse, white in a mouse with discomfort indicated by 
reduced blo od circulation  
 Macroscopic assessment of fur condition and appearance of eyes, inspection 
of body cavities/ fluids  
 Macroscopic assessment of irregularities in breathing ability  
 Indication of pain  
 Macroscopic assessment for signs of automutilation and or fi ghting  
4.5.3 Animal Treatment  
4.5.3.1 Treatment Schedule, Route of Administration, and Dose  
The test compounds were administered i.m. once at a dose of 5 µg (see Figure  2 and 
Figure  3). The control group was treated with buffer only.  
4.5.3.2 Immunization  
For immunization, prior anesthesia by inhalation of 2.5% isoflurane in oxygen, the 
injection site (hind leg) was shaved. Buffer or dissolved test item was applied i.m. into 
the musculus gastrocnem ius in a volume of 20  µL. After immunization and a short 
recovery phase from anesthesia, the animals were observed for any immediate signs 
of discomfort following the immunization procedure.  
4.5.3.3 Blood Sampling via the Retro -Orbital Venous Plexus or 
Vena Facial is 
Blood was sampled via the retro -orbital venous plexus according to SOP -030-074. In 
short, mice were anesthetized by inhalation of 2.5% isoflurane in oxygen and held 
tightly. A thin glass capillary (29  G) was inserted gently through the retro -orbital sin us 
membrane and blood was collected into either Serum tubes (serum preparation) or 
Heparin tubes (flow cytometry analysis ). After careful removal of the glass capillary, 
the restraining grip was loosened. Alternatively, blood collection was performed via t he 
vena facialis  according to SOP -030-074. In short, without prior anesthesia, mice were 
held tightly and using a lancet, the vena facialis  was punctured in a precise and short 
movement. Blood was collected into either Serum tubes (serum preparation) or 
Heparin tubes (flow cytometry analysis) , and the restraining grip was loosened. Blood 
samples were centrifuged at 10,000  x g and ambient temperature for 5  min and serum 
transferred to a pre -labeled 0.5  mL reagent tube, to be stored  at -20°C.  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709064
  
 
R&D Report R -20-0112  Version 01  Page 36 of 105 
  Strictly Confidential  
4.5.4 Endpoint of Exp eriment / Termination Criteria  
Animals were euthanized in accordance with §4 of the German animal welfare act and 
the recommendation of GV -SOLAS by cervical dislocation or by exposure to carbon 
dioxide. Additionally, termination criteria applied according to the specification within 
the respective animal test approval as listed below. Body weight losses exceeding 
20%, or a high severity level in any of the parameters found in Section  4.5.2  were on 
their own suffic ient reason for immediate euthanasia.  
4.5.4.1 Dissection of Animals and Organ Collection  
Following euthanasia, mice were disinfected with 70% ethanol and the dissection was 
performed starting with  an abdominal incisio n. The spleen and dLNs  (popliteal  (PO), 
iliac ( IL) and inguinal (I N), see Figure  5) were collected , pooled  and stored in PBS on 
ice for subsequent sing le cell preparations.  
 
Figure 5: Draining lymph nodes resect ion for subsequent analy sis 
Depicted are  the predicted draining lymph nodes after i.m. injection into the gastrocnemius  muscle used for further 
analysis. Figure  adopted according to  Harrell et al. 2008 . IL, iliac. IN, inguinal. PO, popliteal . 
4.5.5 Preparation of Splenocyte Single Cell Suspensions  
Single cell suspensions from collected spleens were prepared according to SOP -030-
078. To this end, spleens were squeezed throu gh 70 µm cell strainer s using the 
plunger of a syringe to release the splenocytes in to a 50 mL tube. Splenocytes were 
washed with an excess volume of PBS followed by centrifugation at 300  x g for 6  min 
at ambient temperature and discarding the supernatants. Erythrocytes were lysed with 
erythrocyte lysis buffer (154  mM NH 4Cl, 10  mM KHCO 3, 0.1 mM EDTA) for 5  min at 
ambient temperature. The reaction was stopped with an excess volume of PBS. After 
another washing step, cells were resuspended in DC medium (RPMI medium1640 (1x) 
+ GlutaMAX -I [Life Technologies ], 10% FBS, 1% NEAA, 1% sodium -pyruva te, 0.5% 
penicillin/streptomycin, 50 µM 2 -mercaptoethanol), passed through a 70  µm cell 
strainer  again, counted according to SOP -010-028, and stored at 4 °C until further use.  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709065
  
 
R&D Report R -20-0112  Version 01  Page 37 of 105 
  Strictly Confidential  
4.5.6 Preparation of Lymph Node Single Cell Suspensions  
The popliteal, iliac and inguin al dLNs  (Figure  5) were stored together in a plastic tube 
containing 450  µL PBS at ambient temperature in the dark until single cell preparation. 
50 µL collagenase D (10  mg/mL) w ere added to yield a final concentrat ion of 1  mg/mL, 
the dLNs were thoroughly cut into pieces using forceps or scissors, and  incubated for 
10 min at 37 °C. Cells were passed through a 70  µm cell strainer placed on a 50  mL 
plastic tube and minced using the plunger of a 5  mL syringe. The cell st rainer is 
subsequently rinsed using 5  mL of PBS and the cell solution counted  according to 
SOP -010-028.  
4.5.7 RNA Electroporation  
CT26 colon carcinoma  cells (ATCC) were washed once with 10  mL of serum -free X -
Vivo 15  medium, centrifuged (300  ×g, 6 min, ambient t emperature), taken up in 1 –
2 mL of X -Vivo 15 medium, counted (SOP -010-028), and diluted to a concentration of 
25 × 106 cells/mL. S Protein encoding modRNA or irrelevant modRNA  (10 µg in 40  µL 
of X -Vivo 15 medium  each)  was carefully placed at the bottom of a 4 mm 
electroporation cuvette, topped up with 200  µL of cells (corresponding to 5  × 106 cells) 
and shortly mixed by pipetting up and down. Electroporation was then performed with 
a BTX™ ECM™ 830 Square Wave Electroporator applying one 300  V pulse for 15  ms. 
Immediately after electroporation, cells were transferred to a 15  mL tube containing 1 –
2 mL of DC medi um, counted, and diluted to 4  × 105 cells/mL for the cytotoxicity assay , 
and 5  × 105 cells/mL for the IFN γ ELISpot assay  (Section  4.5.8 ). 
4.5.8 ELISpot Assay  
IFNγ ELISpot assay was performed according to SOP -030-110 (with minor 
modifications as descri bed below) using the mouse IFN -γ ELISpotPLUS kit. Briefly, 96 -
well ELISp ot plates were washed with PBS and blocked with serum -containing medium  
(DC medium)  for at least 30  min at 37°C. After  blocking , 100 µl of the splenocyte 
solution (5 x 105 cells)  as well as 100 µl electroporated CT26 cells (5 x 104 cells)  or 
100 µl S pepti de mix  (final concentration per well: 0.1 µg/ml) were added yielding a 
final volume per well of 200 µL. No peptide or irrelevant RNA transfected cells were 
used  as controls . Plates were incubated overnight in a 37°C humidified incubator with 
5% CO 2. After approximately 18  h cells were discarded and a second biotinylated anti -
mouse IFN -γ antib ody incubated for 2  h at ambient temperature . The plate was then 
developed by addition of Streptavidin -ALP for 1 h at ambient  temperature in the dark 
followed by additi on of BCIP®/NBT substrate for 5 –7 min at ambient temperature in 
the dark. Spots were counted on a CTL ELISPOT reader ImmunoSpot® S6 Core 
Analyzer according to SOP -010-099. 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709066
  
 
R&D Report R -20-0112  Version 01  Page 38 of 105 
  Strictly Confidential  
4.5.9 xCELLigence Cytotoxicity Assay  
Preparation of targets:  
Of DC medium, 50 µL per well  were added to a 96 -well PET E -plate to perform a blank 
measurement at an xCELLigence RTCA MP, Real Time Cell Analyzer. Tumor cells 
(50 µL of a 4 × 105 cells/mL  suspension, corresponding to 2  × 104 cells) electroporated 
with S RNA or irrelevant RNA (10  µg each ) were subsequently added to the E -plate. 
After allowing the cell suspension to settle down for 30  min at ambient temperature, 
the E -plate was transferred to the xCELLigence device and measurement was 
continued.  
Peptide loading of targets:  
In mCorVac#1 6, 100 µl S peptide mix (final concentration per well: 0.1 µg/ml) was 
added to S RNA  electroporated tumor cells one hour prior T cell addition. After one 
hour of incubation, the medium was carefully aspirated and the wells were washed 
with PBS twice . Befor e adding the effector cells, 100 µl of DC medium was dispensed 
per well.   
Addition of effectors:  
On the same day, splenocytes were transferred to a T25 cell cult ure flask at a density 
of 1.5 –2 × 106 cells/cm2. S peptide mixes and recombinant IL -2 (Proleu kin) were added 
to yield a final concentration of 0.1  µg/mL and 100  U/mL, respectively, and the cell 
suspension was kept at 37 °C, 5% CO 2 overnight. On the day after, restimulated 
splenocytes were transferred to a 15  mL plastic tube, the T25 flask was rinse d with 
5 mL of MACS buffer and added to the same  tube. Subsequently, CD8+ cells were 
isolated from restimulated splenocytes using CD8a (Ly -2) MACS® MicroBeads 
according to the manufacturer’s instructions. Labeled cells were eluted from MACS LS 
columns, cen trifuged (5  min at 460  ×g), taken up in 1 –2 mL of warm (approximately 
37°C) DC medium, counted (SOP -010-028) and diluted with DC medium to a 
concentration of 6  × 106 cells/mL. CD8+ cells (100 µL) , DC medium or Staurosporin 
(4 µM final concentration) were a dded in duplicate to the targets in the E-plate and the 
xCELLigence measurement was continued for at least three days. RTCA Data analysis 
software or xCELLigence RTCA Software Pro ( both ACEA Biosciences) were used for 
data analysis.  
4.5.10 Cytokine M ultiplex Prot ein Quantification  
Cytokine concentrations were determined in supernatants derived from ex vivo  
restimulated splenocytes and dLN cells. 5  × 105 splenocytes or dLN cells in 100  µL 
medium/well were transferred to a 96 -well U -bottom plate, and 100  µL medium 
supplemented with S peptide mixes to a final concentration of 0.2 µg/mL /peptide /well, 
or cell culture medium only (negative control ) were added and mixed. For each group, 
three samples were treated with 100  µL PMA and i onomycin to a final concentration of 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709067
  
 
R&D Report R -20-0112  Version 01  Page 39 of 105 
  Strictly Confidential  
0.5 µg/mL and 1  µg/mL/well, respectively  (positive controls). Cells were incubated for 
48 h at 37°C, 5% CO 2. Supernatants were harvested and st ored at -20°C for the 
cytokine multiplex assay .  
Cytokine concentrations in supernatants of restimulated splenocyt es and dLN cells 
were determined from thawed cell culture supernatants using a bead -based, 11 -plex 
Th1/Th2 mouse ProcartaPlex immunoassay according to the manufacturer’s 
instructions. Analytes included in the assay were IFNγ, IL -12p70, IL -13, IL -1β, IL -2, IL-
4, IL-5, IL-6, TNF , GM -CSF, and IL-18. 
Fluorescence was measured with the Bioplex200 system and analyzed with 
ProcartaPlex Analyst 1.0 softw are (Thermo Fisher Scientific).   
4.5.11 Flow Cytometry  
All flow cytometric d ata were acquired on a BD Symphony A3 or BD Celesta (B cell 
analysis ) flow cytometer using BD FACSDiva software version 9.1 or 8.0.1.1, 
respectively,  and analy zed with FlowJo 10.6  (FlowJo LLC, BD Biosciences ).  
4.5.11.1 Restimulation of T cells for functional T cell analysis  in the 
spleen and dLN  
For functio nal analysis, splenocytes and dLN cells were  ex vivo  restimulated. 4  × 106 
splenocytes and 1 × 106 (mCorVAC#15) or 2  × 106 (mCorVAC#16) dLN cells in 100  µL 
DC medium/well were transferred to a 96 -well U -bottom plate. To each well, 50  µL 
medium were added, supplemented with either S peptide mix es to a final concentration 
of 0. 2 µg/mL /peptide /well (mCorVAC#15) or 0.5  µg/mL/peptide/well (mCorVAC#16) , 
or medium only  (negative controls) , and mixed. To one sample per group, 50  µL PMA 
and i onomycin to a final conc entration of 0.5  µg/mL and 1  µg/mL/well, respectively,  
were added (positive controls). Three additional wells of any group were added as 
unstained controls.  
Cells were quickly spun down (30  s, 460  × g) and incubated for 1  h at 37 °C, 5% CO 2. 
To each well, 50 µL GolgiStop  and GolgiPlug  in medium were added to a final dilution 
of GolgiStop of 1: 1,500 and GolgiPlug of 1:1,000 , mixed, and cells were furt her 
incubated for 4  h at 37 °C, 5% CO 2.  
4.5.11.2 Functional T cell analysis in the spleen and dLN  
For mouse functional  T cell analysis, restimulated cells (see 4.5.11.1 ) were cent rifuged 
(5 min, 300  × g) and supernatants discarded . Flow cytometry master mixes (MM) for 
functional T cell analysis are depicted in Table  8 and Table  9. 
Cells were stained with fixable viability dye and extracellularly with antibodies against 
CD3, CD4, CD8α, CD44, PD -1, CD40L, CD62L and CXCR5 (mCorVAC#15, MM1 a), 
or CD4, CD8α, CD44, CD45,  PD-1, CD40L, CD62L and CXCR5 mCorVAC#16, MM1 b) 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709068
  
 
R&D Report R -20-0112  Version 01  Page 40 of 105 
  Strictly Confidential  
in Brilliant Stain Buffer  Plus diluted 1:5 in flow buffer (PBS supplemented with 2% FCS, 
2 mM EDTA , 0.01% sodium azide ) in a total volume of 50  µL for 30 min at 2-8 °C. After 
washing cells once with 200 µL flow buffer (5  min, 300  × g), cells were stained with 
streptavidin Brilliant Stain Buffer  Plus diluted 1:5 in flow buffer (MM2). After washing 
cells once with 200 µL flow buffer, cells were fixed with  200 µL 2% RotiHistofix  for 
15 min at room temperature  (mCorVAC#15) and resuspended in  200 µL Perm /Wash  
buffer (FoxP3/Transcription Factor Staining Buffer Set) overnight at 2 -8 °C 
(mCorVAC#15) , or overnight at 2 -8 °C (mCorVAC#16) . After washing cells once with 
200 µL Perm/Wash buffer (5  min, 500  × g) (mCorVAC#16) , permeabilized cells were 
intracellulary treated with 25 µL Fc block (diluted 1:50) for 10  min at 2-8 °C before  IL-
4, TNF, Bcl -6, IFNγ, T -bet and IL -2 antibodies (mCorVAC#15, MM 3a) or  IL-4, TNF, 
IFNγ, T -bet, IL -2 and CD3  (mCorVAC#16, MM 3b) in Perm/Wash bu ffer in a total 
volume of 25  µL were added, and cells incubated for 30 min at 2 -8 °C (staining volume: 
50 µL). After washing cells twice with 200 µL Perm/Wash buffer (5  min, 500  × g), cells 
were resuspended in 200  µL flow buffer. Fluorescence minus 10 (FM1 0) controls were 
stained for viability and with antibodies against CD3, CD8a , CD4 and CD62L  
(mCorVAC#1 5), or CD3, CD8a, CD4, CD45 and CD62L  (mCorVAC#1 6) only.  
Table 8: Flow cytometry antibody master mixes for functional T cell anal ysis in the spleen and dLN 
(mCorVAC#15 and mCorVAC#16).  
Cat, catalog number. LD, LiveDead viability dye. Lot, lot number. MM, master mix.  
MM1a mCorVAC#15  
Fluorochrome  Marker  Clone  Company  Cat Lot Expiry  Dilution  Volume/test 
[µL] 
BUV395  CD3 145-
2C11  BD 563565  9204644  31.05.2022  100 0,5 
BUV563  CD44  IM7 BD 741227  0119427  30.04.2021  2,500  0,1 
BV421  CXCR5  L138D7  BioLegend  145512  B281252  L138D7  50 1 
BV480  CD4 RM4 -5 BD 565634  9016508  31.05.2020  250 0,2 
BV605  PD-1 29F.1A12  BioLegend  135219  B281806  N/A 50 1 
BV785  CD62L  MEL-14 BioLegend  104440  B272550  N/A 200 0,25 
FITC  CD8 30-F11 BD 553079  6197750  31.08.2021  200 0,25 
Biotin  CD40L  MR1  BD 553657  8186567  12.04.2024  100 0,5 
eF780  LD N/A eBioscience  65-0865 -
14 2178170  N/A 1,000  0,05 
 
MM1b mCorVAC#16  
Fluorochro me Marker  Clone  Company  Cat Lot Expiry  Dilution  Volume/test 
[µL] 
BUV563  CD44  IM7 BD 
Biosciences  741227  0119427  30.04.2021  2,500 0,02 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709069
  
 
R&D Report R -20-0112  Version 01  Page 41 of 105 
  Strictly Confidential  
BUV737  CD45  53-6.7 BD 
Biosciences  564297  9030634   N/A 200 0,25 
BV421  CXCR5  L138D7  BioLegend  145512  B281252   N/A 100 0,50 
BV480  CD4 RM4 -5 BD 
Biosciences  565634  9016508  31.05.2020  250 0,20 
BV605  PD-1 29F.1A12  BioLegend  135219  B281806   N/A 50 1,00 
BV785  CD62L  MEL-14 BioLegend  104440   
B258213   N/A 200 0,25 
FITC  CD8 30-F11 BD 
Biosciences  553079  6197750  31.08.2021  200 0,25 
Biotin CD40L  MR1  BD 
Biosciences  553657  8186567  12.04.2024  100 0,50 
eF780  LD N/A eBioscience  65-0865 -
14 2178170  N/A 1,000 0,05 
 
MM2 mCorVAC#16  
Fluorochrome  Marker  Clone  Company  Cat Lot Expiry  Dilution  Volume/test 
[µL] 
PE Streptavidin  N/A BioLegend  405203  B170498  N/A 200 0,25 
 
MM3a mCorVAC#15  
Fluorochrome  Marker  Clone  Company  Cat Lot Expiry  Dilution  Volume/test 
[µL] 
BV711  IL-4 11B11  BD 564005  9276915  21.03.2021  100 0,5 
BB700  TNF MP6-XT22  BD 566510  0021825  31.03.2021  5,000 0,01 
PE Bcl-6 K112 -91 BD 5615 22 9165931  30.06.2022  50 1 
PE-Cy7 IFNγ  XMG1.2  eBioscience  25-
731182  E07672 -
1632  09.2014  1,000  0,05 
AF647  T-bet 4B10  biolegend  644804  B248741  N/A 5,000  0,01 
APC-R700  IL-2 JES6 -5H4 BD 565186  9303906  31.03.2021  5,000  0,01 
 
MM3b mCorVAC#16  
Fluorochrome  Marker  Clone  Company  Cat Lot Expiry  Dilution  Volume/test 
[µL] 
BUV395  CD3 145-2C11  BD 
Biosciences  563565  9204644  31.05.2022  500 0,10 
BV711  IL-4  BD 
Biosciences  564005  9276915  21.03.2021  100 0,5 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709070
  
 
R&D Report R -20-0112  Version 01  Page 42 of 105 
  Strictly Confidential  
BB700  TNF MP6-XT22  BD 
Biosciences  566510  0021825  31.03.2021  5,000  0,01 
PE-Cy7 IFNγ  XMG1.2  eBiosc ience  25-
731182  E07672 -
1632  09.2014  1,000  0,05 
AF647  T-bet 4B10  BioLegend  644804  B248741  N/A 5,000  0,01 
APC-R700  IL-2 JES6 -5H4 BD 
Biosciences  565186  9303906  31.03.2021  5,000  0,01 
4.5.11.3 Phenotypic T cell analysis in the spleen and dLN  
For mouse phenotypic T cell analysis in the spleen and dLNs, 4  × 106 splenocytes and 
1 × 106 (mCorVAC#15) or 1.5  × 106 (mCorVAC#16) dLN cells/well were transferred to 
a 96 -well U bottom plate, c entrifuged (3  min, 300  × g, 2–8°C) and supernatants 
discarded . Flow cytometry MM for  phenotypic T cell analysis are depicted in  Table  9. 
Cells were stained with fixable viability dye and extracellularly with antibodies against 
CD3, CD4, CD8 α, CD25, CD44, PD -1, CD62L, ICOS, CD19  and CXCR5  
(mCorVAC#15, MM1 a), or CD4, CD8α, CD25, CD44, CD45, PD -1, CD62L, ICOS, 
CD19 and CXCR5 ( mCorVAC#16, MM1 b) in Brilliant Stain Buffer Plus diluted 1:5 in 
flow buffer ( PBS supplemented with 2% FCS, 2  mM EDTA , 0.01% sodium azide ) in a 
total volume of 50  µL for 30 min at 2-8 °C. After washing cells twice with 200 µL flow 
buffer (5  min, 300  × g), cells were resuspended in  200 µL 2% RotiHistofix, immediately 
centrifuged (5  min, 300  × g) and fixed again with 200  µL Fix/Perm buffer 
(FoxP3/Transcription Factor Staining Buffer Set)  overnight at 2 -8 °C (mCorVAC#15) , 
or for 20  min at 2 -8 °C and incubated in 200  µL Perm/Wash buffer overnigh t at 2 -8°C 
(mCorVAC#16) . After washing cells once with 200  µL Perm/Wash buffer (5  min, 
500 × g) (mCorVAC#15) , permeabilized cells were intracellular y treated with 25 µL Fc 
block (diluted 1:50) for 10  min at room temperature  before  T-bet, GATA3 , FoxP3 and 
Bcl-6 antibod ies (mCorVAC#15, MM 2a) or T-bet, GATA3, FoxP3 and CD3 
(mCorVAC#16, MM 2b) in Perm/Wash buffer in a total volume of 25  µL, and cells 
incub ated for 30  min at 2 -8 °C (staining volume: 50  µL). After washing cells twice with 
200 µL Perm /Wash  buffer (5  min, 500  × g), cells were resuspended in 200 µL flow 
buffer. Fluorescence minus 10 (FM10) controls were stained for viability and with 
antibodies against CD3, CD8a , CD4, CD62L  and CD19 only.  
Table 9: Flow cytometry antibody master mixes for phenotypic T cell analysis in the spleen and dLN 
(mCorVAC#15 and mCorVAC#16).  
Cat, catalog number. LD, LiveDead viability dye. Lot, lot  number. MM, master mix.  
MM1a mCorVAC#15  
Fluorochrome  Marker  Clone  Company  Cat Lot Expiry  Dilution  Volume/test 
[µL] 
BUV395  CD3 145-2C11  BD 
Biosciences  565992  9204644   31.05.2022  100 0,50 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709071
  
 
R&D Report R -20-0112  Version 01  Page 43 of 105 
  Strictly Confidential  
BUV563  CD44  IM7 BD 
Biosciences  741227  119427   30.04.2021  2,500  0,02 
BV421  CXCR5  L138D7  BioLegend  145512  B281252   N/A 100 0,50 
BV480  CD4 RM4 -5 BD 
Biosciences  565634  9016508   31.05.2020  250 0,20 
BV605  PD-1 29F.1A12  BioLegend  135219  B281806   N/A 50 1,00 
BV711  CD25*  PC61  BD 
Biosciences  740714  119426   30.04.2021  500 0,10 
BV785  CD62L  MEL-14 BioLegend  104440  B272550   N/A 200 0,25 
FITC  CD8 53-6.7 BD 
Biosciences  553031  9143776   31.08.2021  200 0,25 
PerCPeF710  ICOS  7E.17G9  Invitrogen  46-9942 -
82 2029789   30.04.2021  50 1,00 
AF700  CD19  6D5 BioLegend  115528  B261756  N/A 100 0,50 
ef780  LD N/A eBioscience  65-0865 -
14 2178170  N/A 1,000  0,05 
 
MM1b mCorVAC#16  
Fluorochrome  Marker  Clone  Company  Cat Lot Expiry  Dilution  Volume/test 
[µL] 
BUV563  CD44  IM7 BD 
Biosciences  741227  0119427  30.04.2021  2,500  0,02 
BUV737  CD45  53-6.7 BD 
Bioscience s 564297  9030634   N/A 200 0,25 
BV421  CXCR5  L138D7  BioLegend  145512  B281252   N/A 100 0,50 
BV480  CD4 RM4 -5 BD 
Biosciences  565634  9016508  31.05.2020  250 0,20 
BV605  PD-1 29F.1A12  BioLegend  135219  B281806   N/A 50 1,00 
BV711  CD25  PC61  BD 
Biosciences  740714  0119426  30.04.2021  500 0,10 
BV785  CD62L  MEL-14 BioLegend  104440  B272550   N/A 200 0,25 
FITC  CD8 30-F11 BD 
Biosciences  553031  9143776  31.08.2021  200 0,25 
PerCPeF710  ICOS  7E.17G9  Invitrogen  46-9942 -
82 2029789  30.04.2021  50 1,00 
AF700  CD19  6D5 BioLegend  115528 B261756   N/A 100 0,50 
eF780  LD N/A eBioscience  65-0865 -
14 2178170  N/A 1,000  0,05 
 
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709072
  
 
R&D Report R -20-0112  Version 01  Page 44 of 105 
  Strictly Confidential  
MM2a mCorVAC#15  
Fluorochrome  Marker  Clone  Company  Cat Lot Expiry  Dilution  Volume/test 
[µL] 
PE Bcl-6  BD 
Biosciences  561522  9165931   
30.06.2022  100 0,5 
PECF594  FoxP3  MF23  BD 
Biosciences  562466  9276149  28.20.2021  200 0,25 
PE-Cy7 GATA3  TWAJ  Invitrogen  25-9966 -
42 2142972  N/A 25 2 
AF647  T-bet 4B10  BioLegend  644804  B248741   N/A 100 0,5 
 
MM2b mCorVAC#16  
Fluorochrome  Marker  Clone  Company  Cat Lot Expiry  Dilution  Volume/te st 
[µL] 
BUV395  CD3 145-2C11  BD 
Biosciences  563565  9204644  31.05.2022  50 0,50 
PE-CF594  FoxP3  MF23  BD 
Biosciences  562466  9276149  28.20.2021  200 0,25 
PE-Cy7 GATA3  TWAJ  Invitrogen  25-9966 -
42 2142972   N/A 25 2,00 
AF647  T-bet 4B10  BioLegend  644804  B248741   N/A 5,000  0,01 
4.5.11.4 Phenotypic T cell analysis in the blood  
For mouse phenotypic T cell analysis in peripheral blood, 50 µL freshly drawn blood 
were transferred to round bottom 5 -mL tubes, washed once with 500  µL PBS (Gib co) 
(300 × g, 8 min) and the cell pellet  was resuspended in 2  mL ACK lysing buffer (Gibco) 
and incubated for 3  min at room temperature. Flow cytometry master mixes (MM) for 
phenotypic T cell analysis are depicted in Table  10. 
Cells were washed twice with 1 mL flow buffer (300 × g, 8 min) and stained with fixable 
viability dye and anti -CXCR5 (rat IgG2a) antibody in the presence of Fc block diluted 
1:100) in flow buffer in a total volume of 50  µL for 20  min at room temperature  (MM1) . 
After washing cells twic e with 1  mL flow buffer ( 8 min, 300 × g), cells were stained  with 
anti-rat IgG2a biotin in flow buffer in a total volume of 50  µL for 20  min at 2-8 °C (MM2) . 
After washing cells twice with 1  mL flow buffer ( 8 min, 300  × g), cells were stained 
extracellular ly with antibodies against CD3, CD4, CD8 α, CD25, CD38, CD44, PD -1, 
CD62L, ICOS, CD127 (4 -1BB), CD19 and streptavidin  (mCorVAC#15 , MM3a ), or CD4, 
CD8α, CD25, CD38, CD44, PD -1, CD62L, ICOS, CD127 (4 -1BB), CD19 and 
treptavidin  (no CD3, mCorVAC#16 , MM3b ) in Brilliant Stain Buffer Plu  diluted 1 5 in 
flow buffer in a total volume of 50  µL for 20  min at 2 -8 °C. After washing ce lls once with 
1 mL flow buffer (5  min, 300 × g), cells were fixed in 200  µL 2% RotiHistofix for 15  min 
at room temperature  (mCorVAC#15), or centrifuged immediately after mixing (5 min, 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709073
  
 
R&D Report R -20-0112  Version 01  Page 45 of 105 
  Strictly Confidential  
300 × g) and fixed again with 200  µL Fix/Perm buffer (FoxP3/Transcription Factor 
Staining Buffer Set) for 20  min at 2 -8 °C (mCorVAC#16) . After centrifugation ( 5 min, 
500 × g), cells were resuspended in 200 µL Perm /Wash  buffer (FoxP3/Transcription 
Factor Staining Buffer Set) and incubated over night at 2 -8 °C. Permeabilized cells 
were centrifuged ( 5 min, 500  × g) and intracellulary treated with 25 µL Fc block  (diluted 
1:50)  in Perm/Wash buffer  for 10  min at 2-8 °C before  T-bet and GATA3 antibod ies 
(mCorVAC#15 , MM4a ) or CD3, FoxP3, T-bet and GATA3 antibod ies (mCorVAC#16 , 
MM4b ) in Perm /Wash  buffer in a total volume of 25  µL were added , and cells incubated 
for 30 min at 2 -8 °C  (staining volume: 50  µL). After washin g cells twice with 1  mL 
Perm /Wash  buffer ( 5 min, 500  × g), cells were resuspended in 150  µL flow buffer. 
Fluorescence minus 10 (FM10) controls were stained for viability and with antibodies 
against CD3, CD8a , CD4, CD62L , CD19  and streptavidin only.  
Table 10: Flow cytometry antibody master mixes for phenotypic T cell analysis in the blood (mCorVAC#15 
and mCorVAC#16).  
Cat, catalog number. LD, LiveDead viability dye. Lot, lot number. MM, master mix.  
MM1  
Fluorochrome  Marker  Clone  Company Cat Lot Expiry  Dilution  Volume/test 
[µL] 
Purifi ed CXCR5  2G8 BD 
Biosciences  551961  9143926  28.02.2027  100 0,50 
eF780  LD N/A eBioscience  65-0865 -
14 2178170  N/A 1000  0,05 
 N/A Fc block  2.4G2  BD 553142  0028326  31.05.2027  100 0,50 
 
MM2  
Fluorochrome  Marker Clone  Company  Cat Lot Expiry  Dilution  Volume/test 
[µL] 
Biotin  IgG2a  RG7/1.30  BD 
Biosciences  553894  9288614  31.05.2024  100 0,50 
 
MM3a mCorVAC#15  
Fluorochrome  Marker Clone Company  Cat Lot Expiry Dilution Volume/test 
[µL] 
BUV395  CD3 145-2C11  BD 56356 5 9204644  31.05.2022  100 0,50 
BUV563  CD44  IM7 BD 
Biosciences  741227  0119427  30.04.2021  2,500 0,02 
BUV737  CD8a  53-6.7 BD 
Biosciences  564297  9030634   N/A 200 0,25 
BV421  Streptavidin  N/A BD 
Biosciences  563259  9197684  31.12.2021  200 0,25 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709074
  
 
R&D Report R -20-0112  Version 01  Page 46 of 105 
  Strictly Confidential  
BV480  CD4 RM4 -5 BD 
Biosciences  565634  9016508  31.05.2020  250 0,20 
BV605  PD-1 29F.1A12  BioLegend  135219  B281806   N/A 50 1,00 
BV711  CD25  PC61  BD 
Biosciences  740714  0119426  30.04.2021  500 0,10 
BV785  CD62L  MEL-14 BioLegend  104440  B258213  N/A 200 0,25 
AF488  CD38  90 BioLegend  102714  B298187  N/A 100 0,50 
PerCPeF710  ICOS  7E.17G9  Invitrogen  46-
9942 -82 2029789  30.04.2021  50 1,00 
PE 4-1BB 17B5  eBioscience  12-
1371 -82 E01500 -
1632  N/A 100 0,50 
PE-Cy7 GATA3  TWAJ  Invitrogen  25-
9966 -42 B2142972   N/A 25 2,00 
AF647  T-bet 4B10  BioLegen d 644804  B248741   N/A 5000  0,01 
AF700  CD19  6D5 BioLegend  115528  B261756   N/A 100 0,50 
 
MM3b mCorVAC#16  
Fluorochrome  Marker Clone Company  Cat Lot Expiry Dilution Volume/test 
[µL] 
BUV563  CD44  IM7 BD 
Biosciences  741227  0119427  30.04.2021  2500  0,02 
BUV737  CD8a  53-6.7 BD 
Biosciences  564297  9030634   N/A 200 0,25 
BV421  Streptavidin  N/A BD 
Biosciences  563259  9197684  31.12.2021  200 0,25 
BV480  CD4 RM4 -5 BD 
Biosciences  565634  9016508  31.05.2020  250 0,20 
BV605  PD-1 29F.1A12  BioLegend  135219  B281806  N/A 50 1,00 
BV711  CD25  PC61  BD 
Biosciences  740714  0119426  30.04.2021  500 0,10 
BV785  CD62L  MEL-14 BioLegend  104440  B258213  N/A 200 0,25 
AF488  CD38  90 BioLegend  102714  B298187  N/A 100 0,50 
PerCPeF710  ICOS  7E.17G9  Invitrogen  46-
9942 -82 2029789  30.04.2021  50 1,00 
PE 4-1BB 17B5  eBioscience  12-
1371 -82 E01500 -
1632  N/A 100 0,50 
PE-Cy7 GATA3  TWAJ  Invitrogen  25-
9966 -42 B2142972  N/A 25 2,00 
AF647  T-bet 4B10  BioLegend  644804  B248741  N/A 5000  0,01 
AF700  CD19  6D5 BioLegend  115528  B261756  N/A 100 0,50 
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709075
  
 
R&D Report R -20-0112  Version 01  Page 47 of 105 
  Strictly Confidential  
MM4a  mCorVAC#15  
Fluorochrome  Marker Clone Company  Cat Lot Expiry Dilution Volume/test 
[µL] 
PE-CF594  FoxP3  MF23  BD 
Biosciences  562466  9276149  28.02.2021  200 0,25 
PE-Cy7 GATA3  TWAJ  Invitrogen  25-9966 -
42 B2142972  N/A 25 2,00 
AF647  T-bet 4B10  BioLegend  644804  B248741  N/A 5,000  0,01 
 
MM4b mCorVAC#16  
Fluorochrome  Marker Clone Company  Cat Lot Expiry Dilution Volume/test 
[µL] 
BUV395  CD3 145-2C11  BD 
Biosciences  563565  9204644  31.05.2022  50 0,50 
PE-CF594  FoxP3  MF23  BD 
Biosciences  562466  9276149  28.02.2021  200 0,25 
PE-Cy7 GATA3  TWAJ  Invitrogen  25-9966 -
42 B2142972  N/A 25 2,00 
AF647  T-bet 4B10  BioLegend  644804  B248741  N/A 5,000  0,01 
4.5.11.5 B cell analysis in the spleen and dLN  
For mouse B cell analysis in the spleen and dLNs, 1  × 106 splen ocytes and  2.5 × 105 
dLN cells/well were transfer red to a 96 -well V bottom plate, centrifuged (5  min, 300  × g, 
2–8 °C) and supernatants discarded.  Flow cytometry MM for B cell analysis are 
depicted in  Table  11.  
Cells were treated with Fc block  (diluted 1: 50) in 50 µL flow buffer for 15  min at 2-8 °C 
and cells were stained  with fixable viability dye and  extracellularly with antibodies 
against CD19, CD45R/B220, IgD, CD138, IgM, CD38, CD95/FAS, IgG1, IgG2a, GR -
1, F4/80, CD4  and CD8a (mCorVAC#15, MM1 a) in Brilliant St ain Buffer in a total 
volume of 50  µL for 20  min at 2 -8 °C (staining volume: 100  µL); or cells were directly 
treated with fixable viability dye and extracellularly with antibodies against  CD19, 
CD45R/B220, IgD, CD138, IgM, CD38, CD95/FAS, GR -1, F4/80, CD4  and CD8a 
(mCorVAC#16, MM1b), in Brilliant Stain Buffer in a total volume of 100  µL for 20  min 
at 2-8 °C (staining volume: 100  µL). In addition, cells were treated with Fc block  (diluted 
1:50)  in 50  µL flow buffer for 15  min at 2-8 °C and stained with fixab le viability dye and 
extracellularly with antibodies against with PD-L2, CD45R/B220, CD19, CD73, IgM, 
CD80, GR-1, F4/80, CD4  and CD8a  in Brilliant Stain Buffer in a total volume of 50  µL 
(mCorVAC#15 , MM3 ) (staining volume: 100  µL); or cells were directly t reated with 
fixable viability dye and extracellularly with MM3 (mCorVAC#16) in Brilliant Stain Buffer 
in a total volume of 100  µL for 20  min at 2 -8 °C (staining volume: 100  µL). After 
washing cells twice with 200 µL flow buffer ( 5 min, 400  × g, 2–8 °C), cells were fixed 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709076
  
 
R&D Report R -20-0112  Version 01  Page 48 of 105 
  Strictly Confidential  
with 200  µL 2% RotiHistofix and incubated over night at 2 -8 °C. After washing cells 
once with 200 µL flow buffer (5  min, 400 × g), cells were resuspended in 100 µL flow 
buffer  (mCorVAC#15), or stained intracellularly with antibodies against IgG1 and 
IgG2a (MM2) in Perm/Wash buffer in a total volume of 50  µL for 30  min at 2-8 °C 
(staining volume: 50  µL), before being resuspended in 100  µL flow buffer 
(mCorVAC#16) . Fluorescence minus Fas/CD138 (FM Fas/CD138) controls were 
stained for MM1 a and M M1b excluding  CD95/FAS and CD138 ; fluorescence minus 
IgG2a (FM IgG2a) controls were stained for MM1 a excluding IgG2a ; fluorescence 
minus IgG1 (FM IgG1) controls were stained for MM1 a excluding IgG1 ; fluorescence 
minus 34 (FM 34) controls were stained for M M1b excluding CD138 and CD95/FAS; 
fluorescence minus CD73 and CD80 (FM 73/80) controls were stained for MM 3 
excluding CD73  and CD80; fluorescence minus PD -L2 (FM PD -L2) controls were 
stained for MM 3 excluding PD -L2; and fluorescence minus 35 (FM 35) contro ls were 
stained for MM3 excluding PD -L2, CD73 and CD80.  
Table 11: Flow cytometry antibody master mixes for B cell analysis in the spleen and dLN (mCorVAC#15 
and mCorVAC#16).  
Cat, catalog number. LD, LiveDead viability dye. Lot, lot  number. MM, master mix.  
MM1a mCorVAC#15  
Fluorochrome  Marker Clone Company  Cat Lot Expiry Dilution Volume/t
est [µL] 
FITC  FAS/CD95  Jo2 BD 
Biosciences  561979  8296755  30.11.2023  100 1 
PE CD38  90 Thermo 
Fisher  12-0381 -
82 2150667  25.04.2021  400 0,25 
PerCPCy 5.5 Gr1 RB6-8C5 BioLegend  108428  B278340  N/A 800 0,12 
PerCPCy5.5  F4/80  BM8 BioLegend  123128  B276793  N/A 800 0,12 
PerCPCy5.5  CD4 RM4 -5 BioLegend  100540  B261856  N/A 800 0,12 
PerCPCy5.5  CD8 53-6.7 BD 
Biosciences  551162  9098816  31.05.2023  800 0,12 
PE-Cy7 IgM R6-60.2 BD 
Biosciences  552867  9269114  18.07.2021  200 0,5 
AF647  CD45R/B22
0 RA3-6B2 BioLegend  103226  B243962  N/A 1,500  0,07 
eF780  LD N/A eBioscience  65-0865 -
14 2178170  N/A 1,600  0,06 
BV421  IgD 11-26c.2a  BioLegend  405725  B280598  N/A 2,500  0,04 
BV510  IgG1 A85-1 BD 746811  0115095  30.04.2021  200 0,5 
BV605  CD138  281-2 BioLegend  142531  B299222  N/A 200 0,5 
BV711  IgG2a  R19-15 BD 744533  0115092  30.04.2021  200 0.5 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709077
  
 
R&D Report R -20-0112  Version 01  Page 49 of 105 
  Strictly Confidential  
BV785  CD19  1D3 BD 
Biosciences  563333  0023948  30.06.2021  1,000  0.1 
 
MM1b mCorVAC#16  
Fluorochrom e Marker Clone Company  Cat Lot Expiry Dilution Volume
/test 
[µL] 
FITC  FAS/CD95  Jo2 BD 
Biosciences  561979  8296755  30.11.2023  100 1 
PE CD38  90 Thermo 
Fisher  12-0381 -
82 2150667  25.04.2021  400 0,25 
PerCPCy5.5  Gr1 RB6-8C5 BioLegend  108428  B278340  N/A 800 0,12 
PerCPCy5.5  F4/80  BM8 BioLegend  123128  B276793  N/A 800 0,12 
PerCPCy5.5  CD4 RM4 -5 BioLegend  100540  B261856  N/A 800 0,12 
PerCPCy5.5  CD8 53-6.7 BD 
Biosciences  551162  9098816  31.05.2023  800 0,12 
PE-Cy7 IgM R6-60.2 BD 
Biosciences  552867  9269114  18.07.2021  200 0,5 
AF647  CD45R/B220  RA3-6B2 BioLegend  103226  B243962  N/A 1,500  0,07 
eF780  LD N/A eBioscience  65-0865 -
14 2178170  N/A 1,600  0,06 
BV421  IgD 11-26c.2a  BioLegend  405725  B280598  N/A 2,500  0,04 
BV605  CD138  281-2 BioLegend  142531  B299222  N/A 200 0,5 
BV785  CD19  1D3 BD 
Biosciences  563333  0023948  30.06.2021  1,000  0.1 
 
MM2 mCorVAC#16  
Fluorochrome  Marker Clone Company  Cat Lot Expiry Dilution Volume
/test 
[µL] 
BV510  IgG1  A85-1 BD 746811  0115095  30.04.2021  400 0,125  
BV711  IgG2a  R19-15 BD 744533  0115092  30.04.2 021 400 0,125  
 
MM3  
Fluorochrome  Marker Clone Company  Cat Lot Expiry Dilution Volume
/test 
[µL] 
BV421  PD-L2 TY25  BD 
Biosciences  564245  9204505  30.11.2021  600 0.2 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709078
  
 
R&D Report R -20-0112  Version 01  Page 50 of 105 
  Strictly Confidential  
BV605  CD45R/B22
0 RA3-6B2 BioLegend  103244  B305934  N/A 800 0,12 
BV786  CD19  1D3 BD 
Bioscienc es 563333  0023948  30.06.2021  1,000  0,1 
PE CD73  TY/11.8  BioLegend  127206  B267137  N/A 600 0,2 
PerCPCy5.5  Gr1 RB6-8C5 BioLegend  108428  B278340  N/A 800 0,12 
PerCPCy5.5  F4/80  BM8 BioLegend  123128  B276793  N/A 800 0,12 
PerCPCy5.5  CD4 RM4 -5 BioLegend  100540  B261856  N/A 800 0,12 
PerCPCy5.5  CD8 53-6.7 BD 
Biosciences  551162  9098816  31.05.2023  800 0,12 
PE-Cy7 IgM R6-60.2 BD 
Biosciences  552867  9269114  18.07.2021  200 0,5 
AF647  CD80  16-10A1  BioLegend  104718  B278896  N/A 400 0,25 
eF780  LD N/A eBioscience  65-0865 -14 2178170  N/A 1,600 0,06 
4.5.11.6 Myeloid cell analysis in the spleen  
For mouse myeloid cell analysis in the spleen, 2  × 106 splenocytes/well were 
transferred to a 96 -well U bottom plate, c entrifuged (3  min, 460  × g) and supernatants 
discarded.  Flow cytometry MM fo r myeloid cell analysis is depicted in Table  12.  
Cells were stained with Fc block and fixable viability dye  in PBS in a total volume of 
100 µL (MM1) for 15  min at 2 -8 °C. After washing cells once with 200  µL PBS (3  min, 
460 × g), cells were stained extracellularly with antibodies against CD8, CD45, BST2, 
CD86, XCR1, MHC class II, CD11b, PD -L1, CD103, F4/80, CD11c and GR -1 in Brilliant 
Stain Buffer in a total volume of 50  µL (MM2) for 30 min at 2-8 °C (staining volum e: 
50 µL). After washing cells once  with 200 µL PBS (3 min, 460 × g), cells wer e fixed 
with 1 00 µL Fix/Perm buffer (FoxP3/Transcription Factor Staining Buffer Set) for 
30 min at 2-8 °C. After washing cells twice  with 200  µL Perm/Wash buffer (3 min, 
460 × g), cells were resuspended in 200  µL Perm/Wash buffer and incubated overnight 
at 2-8 °C. Permeabilized cells were centrifuged (3  min, 460  × g) and intracellular ly 
treated with CD206 antibody  in Perm/Wash buffer in a total volume of 50 µL (MM3) for 
30 min at  2-8 °C  (staining volume: 50  µL). After washing cells twice with 200 µL 
Perm/Wash buffer (3 min, 460  × g), cells were resuspended in 200  µL flow buffer.  
Table 12: Flow cytometry antibody master mixes for myeloid cell analysis in th e spleen (mCorVAC#15 and 
mCorVAC#16).  
Cat, catalog number. LD, LiveDead viability dye. Lot, lot number. MM, master mix.  
MM1  
Fluorochrome  Marker Clone Company  Cat Lot Expiry Dilution Volume/test 
[µL] 
BV605 -like LD N/A ThermoFish
er L34959  1921586  N/A 800 0,06 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709079
  
 
R&D Report R -20-0112  Version 01  Page 51 of 105 
  Strictly Confidential  
N/A Fc block  2.4G2  BD 553142  0028326  31.05.2027  100 0,50 
 
MM2  
Fluorochrom
e Marker Clone Company  Cat Lot Expiry Dilution Volume/tes
t [µL] 
BUV395  CD45  30-F11 BD 
Biosciences  564279  9016570  N/A 100 0,50 
BUV737  CD8 53-6.7 BD 
Biosciences  564297  90306 34 N/A 100 0,50 
eF450  BST2  eBio927  invitrogen  48-3172 -82 2055199  N/A 100 0,50 
BV510  CD86  GL-1 BioLegend  105039  B264604  N/A 100 0,50 
BV650  XCR1  ZET BioLegend  148220  B265588  N/A 100 0,50 
BV786  MHC II  M5/114.15.
2 BD 
Biosciences  742894  9333783  30.11.2020  500 0,10 
FITC  CD11b  M1/70  BD 
Biosciences  553310  8295813  31.08.2024  200 0,25 
PerCP -Cy5.5  PD-L1 10F.9G2  BioLegend  124333  B286738  N/A 100 0,50 
PE CD103  Invitrogen  12-1031 -83 2054351  26.12.2021  N/A 400 0,13 
PE-Dazzle594  F4/80  BM8 BioLegend  123145  B268244  N/A 100 0,50 
APC CD11c  N418  Miltenyi  130-119-
802/130 -
102-493 5200308676/
25200308676  24.3.2021/1
3.12.2015  100 0,50 
APC-Cy7 GR-1 RB-8C5 BioLegend  108423  B209677  N/A 800 0,06 
 
MM3  
Fluorochrome  Marker Clone Company  Cat Lot Expiry Dilution Volume/test 
[µL] 
PE-Cy7 CD206  C068C2  BioLegend  141719  B260552  N/A 400 0,13 
4.5.12 Statistical Analysis  
GraphPad Prism 8 Software (La Jolla, USA) was used for statistical analysis and figure  
generation. The following tests were used for data analysis:  
Table 13: Statistical analyses  
Data set  Comparison  Statistical test  
Flow cytometry, immune cell 
subsets  Test groups vs. control group  One-way ANOVA  and Dunnett’s 
posttest  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709080
  
 
R&D Report R -20-0112  Version 01  Page 52 of 105 
  Strictly Confidential  
ELISpot assay  Test groups vs. control group  Repeated measurement o ne-way 
ANOVA and Sidak’s posttest  
Th1/Th2 cytokines  Test groups vs. control group  Two-way ANOVA and Sidak ’s 
posttest  
 
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709081
  
 
R&D Report R -20-0112  Version 01  Page 53 of 105 
  Strictly Confidential  
5 RESULTS  
5.1 ELISpot assay  
BALB/c mice were euthanized on day 12 ( BNT162a1, BNT162b1, BNT162b2 ) or day 
27 (BNT162c2) after vaccination. Isolated splenocytes w ere restimulated with S -
specific overlapping peptide mixes  (S peptide) or CT26 cells electroporated with RNA 
encoding the full -length S protein (S RNA).  Recognition of S RNA transfected cells 
served as an additional proof for successful processing of S -specific epitopes.  Cells 
cultivated without the presence of a peptide (No peptide)  or control RNA electroporated 
CT26 cells (Control RNA) served as control. Statistical significance was assessed by 
repeated measurement one -way ANOVA and Sidak’s  multiple compa rison post -test. 
Raw data can be found in Table  19.  
 
Figure 6: ELISpot analysis  using splenocytes fro m animals treated with BNT162a1, BNT162b1 , BNT162b2 
or BNT162c2  
ELISpot assay of splen ocytes from BNT162a1 or BNT162b1 ( a) or BNT162b2 or BNT162c2 ( b) vaccinated mice  
(n=8 per group) . Cells were isolated on day 12 (BNT162a1 , BNT162b1 , BNT162b2) or day 27 (BNT162c2)  after 
vaccination . Splenocytes were restimulated with S -specific overlapping  peptide mixes  and IFN γ secretion was 
measured to assess T -cell responses. Mean spot counts  per mouse  are shown by dots; group mean values are 
indicated by bars.  One sample in the BNT162b2 group in response to  S peptide and S RNA restimulation yielded 
results that were too numerous to count ; these values were set to 1,500.  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709082
  
 
R&D Report R -20-0112  Version 01  Page 54 of 105 
  Strictly Confidential  
Saturating amounts of IFNγ spots were detected in groups receiving BNT162b1, 
BNT162b2  or BNT162c2 after restimulation with either S peptide or S RNA. Mean spot 
counts were as high as 750 for BNT162b1 and exceeded 1,000 for BNT162b2 and 
BNT162c2. Low but significant spot counts were detected for BNT162a1, reaching a 
mean of 100 after S peptide restimulation and 36 after S RNA restimulation.  
5.2 Flow Cytometry  
Flow cytometry was applied to furth er characterize T - and B -cell numbers, activation 
status , functional profile  and subtypes after vaccination  in the blood, spleen and dLNs . 
dLNs were analyzed for functionality but are not further described in this report. Myeloid 
cell subsets  in the spleen  were  analyzed but are not further described  in this report.  
dLNs were not assayed for myeloid cell subsets due to insufficient cell numbers ( for 
further details see  Section 2.5). Statistical significance compari ng the vaccinated 
groups to the respective control group was determined by one -way ANOVA and 
Dunnett’s  multiple comparison post -test. Raw data for analyzed immune cell subsets  
including tissues and subsets not described here  can be found in Attachment I . Gating 
strategies can be found in Attachment II.  
Phenotypic T - and B -cell analysis in the b lood 
Blood was analyzed 7 days after vaccination. The CD8+ T cell percentage among CD3+ 
T cells in the blood was significantly increased around 45% to  a mean of  34% f or 
BNT162b2  treated mice with a  corresponding decrease in CD4+ T cells ( Figure  7a,b). 
No change in the percentage of CD8+ or CD4+ T cells among CD3+ T cells was 
observed in any other group . A significant increase of  TFH cells among CD4+ T cells 
was observed in the BNT162b1, BNT162b2 and BNT162c2  groups ( Figure  7c). 
Highest T FH levels with a mean of 1.34% were found  for BNT162c2  followed by 
BNT162b2  (0.53%) and BNT162b1 (0.48%) . 
Among lymphocytes, B cell levels were significantly reduced in all groups, suggesting 
a redistribution from the blood into secondary lymphoid organs ( Figure  7d). 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709083
  
 
R&D Report R -20-0112  Version 01  Page 55 of 105 
  Strictly Confidential  
 
Figure 7: Analysis of ly mphocyte frequencies in the blood of BNT162a1, BNT162b1, BNT162b2 or BNT162c2  
vaccinated mice  
Flow cytometry analysis  of blood 7 days post BNT162a1, BNT162b1, BNT162b2 or BNT162c2  treatment  (N=8 per 
group) . Buffer treated mice served as control.  For BNT162 c2, the control group of mCorVAC#15 served as control 
(sample processing and acquisition on the same day). Cell fractions  per mouse are shown by dots; group mean 
values are indicated by bars .  
The fraction of activated T cells was particularly elevated whe n mice were treated with 
BNT162b 1 or BNT162b2 . In these groups, CD8+ T cells significantly upregulated 
CD44, CD38, PD -1 as well as ICOS ( Figure  8a). ICOS expression was also elevated 
among CD4+ T cells ( Figure  8b). The fraction of ICOS+ TFH cells was increased in all 
vaccinated groups but most significantly for B NT162b1, BNT162b2 and BNT162c2  
(Figure  8c).  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709084
  
 
R&D Report R -20-0112  Version 01  Page 56 of 105 
  Strictly Confidential  
 
Figure 8: Analysis of T cell activation  in the blood of BNT162a1, BNT162b1, BNT162b2 or BNT162c2  
vaccinated mice  
Flow cytometry analysis of blood 7 days after BNT162a1, BNT162b1, BNT162b2 or BNT162c2  vaccination  (N=8 
per group) . Buffer treated mice se rved as control.  Cell fractions  per mouse are shown by dots; group mean values 
are indicated by bars.   
Phenotypic T - and B -cell analysis dLNs 
dLNs were analyzed  12 days  (BNT162a1, BNT162b1, BNT162b2 ) or 27  days  
(BNT162c2) after vaccination . As shown for the frequ ency among CD3+ T cells in the 
blood ( Figure  7a), CD8+ T cell counts in the dLNs were significantly elevated in the 
BNT162b2  group ( Figure  9a). CD4+ T cells  as well as T FH cells were significantly 
increased in mice treated with BNT162b1  or BNT162b2  (Figure  9b,c). T H1 T cell 
increase  was most pronounced  in the BNT162b1 ( P=0.0134) and BNT162b2 
(P=0.0531) groups  (Figure  9d). 
In line with increased T FH cell counts, B cell numbers were highest in BNT162b1 
(P=0.0053) and BNT162b2 ( P>0.0001) vaccinated mice ( Figure  10a). Among B cells, 
antibody secreting plasma B cells, class switched B cells and germinal center B cells 
crucial for affinity maturation of antibodies were significantly expanded ( Figure  10b-d). 
In BNT162a1, BNT162b1 and BNT162b2  groups  only, germinal center B c ells 
demonstrated  a class switch to IgG1 (BNT162a1,  BNT162b1 and BNT162b2) or IgG2a 
(BNT162b1 and BNT162b2) (Figure  10e,f).  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709085
  
 
R&D Report R -20-0112  Version 01  Page 57 of 105 
  Strictly Confidential  
 
Figure 9: Analysis of T cell counts in the dLNs of BNT162a1, BN T162b1, BNT162b2 or BNT162c2  vaccinated 
mice 
Flow cytometry analysis of T cells in  the dLNs  after BNT162a1, BNT162b1, BNT162b2 or BNT162c2  vaccination 
(N=8 per group) . Cells were isolated on day 12 (BNT162a1, BNT162b1, BNT162b2) or day 27 (BNT162c2) after 
vaccination . Buffer treated mice se rved as control.  Cell counts  per mouse are shown by dots; group mean values 
are indicated by bars.   
 
Figure 10: Analysis of B cell counts in the dLNs of BNT162a1, BNT162b1, BNT162b2 or BNT162c2  
vaccinated mice  
Flow cytometry analysis of B cells in  the dLNs after BNT162a1, BNT162b1, BNT162b2 or BNT162c2  vaccination  
(N=8 per group) . Cells were isolated on day 12 (BNT162a1, BNT162b1, BNT162b2) or day 27 (BNT162c2) after 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709086
  
 
R&D Report R -20-0112  Version 01  Page 58 of 105 
  Strictly Confidential  
vaccination . Buffer treated mi ce se rved as control.  Cell counts  per mouse are shown by dots; group mean values 
are indicated by bars.   
Phenotypic T - and B -cell analysis in the spleen  
Analysis of T cells and B cells in the spleen revealed similar but less pronounced 
results compared to blood and dLNs. T FH cells, germinal center B cells and class 
switch ed B cells were sig nificantly increased upon BNT162b1 or BNT162b2 
vaccination ( Figure  11).  
 
Figure 11: Analysis of T FH and B cell counts in the spleen of BNT162a1, BNT162b1, BNT162b2 or BNT162c2  
vaccinated mice  
Flow cytometry analysis of TFH cells (a), germinal center B cells ( b) and class switched B cells ( c) in the spleen  after 
BNT162a1, BNT162b1, BNT162b2 or BNT162c2  vaccination  (N=8 per group) . Cells were isolated on day 12 
(BNT162a1, BNT162b1, BNT162b2) or day 27 (BNT162c2) after vaccination . Buffer treated mice se rved as control.  
Cell counts  per mouse are shown by dots; group mean values are indicated by bars.   
Function al T-cell analysis in the spleen  
Splenocytes  were  analyzed by i ntracellular cytokine staining 12 days ( BNT162a1, 
BNT162b1, BNT162b2 ) or 27 days (BNT162c2) after vaccination, to quantify  antigen -
specific T cells via flow cytometry. Secretion of IFNγ, IL -2 or TNF w as determined  in 
unstimulated or S peptide restimulated samples . Responses without stimulation were 
subtracted from S peptide stimulated samples from the same mouse and depicted for 
each treatment group. Cytokine responses in vaccinated animals were  compared to 
buffer treated mice (Control)  (Figure  12). 
In line with ELISpot data ( Figure  6), significant antigen -specific secretion of IFNγ 
among CD8+ T cells was detectable  in splenocytes of BNT162b1, BNT162b2 and 
BNT162c2 vaccinated  animals.  CD8+ T cells from BNT162b1  and BNT162b2 
vaccinated mice also showed significant release of IL -2 and TNF ( Figure  12a). 
Significant numbers of CD4+ T cells from BNT162b1 vaccinated mice secreted the T H1 
cytokines IFNγ  and IL-2, but not the T H2 cytokine IL -4 (Figure  12b). Although numbers 
were generally low and the spread  between treat ed groups high, significant antigen -
specific secretion of IFNγ among T FH cells w as detected in the BNT162b 2 group 
(Figure  12c).   
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709087
  
 
R&D Report R -20-0112  Version 01  Page 59 of 105 
  Strictly Confidential  
 
Figure 12: Quantification  of cytokine secreting T cells upon S peptide restimulation  in the spleen of 
BNT162a1, BNT162b1, BNT162b2 or BNT1 62c2 vaccinated mice  
Flow cytometry analysis of cytokine secreting CD8+ (a), CD4+ (b) and T FH cells (c) upon S peptide restimulation. 
Splenocytes of BNT162a1, BNT162b1, BNT162b2 or BNT162c2  vaccinated  mice (N=8 per group)  were isolated on 
day 12 (BNT162a1,  BNT162b1, BNT162b2) or day 27 (BNT162c2) after vaccination . Splenocytes of b uffer treated 
mice se rved as control.  Cytokine positive c ell counts  per mouse are shown by dots; group mean values are indicated 
by bars.  Values represent S peptide  restimulated s amples subtracted by unstimulated samples from the same 
mouse.  
In summary, particularly BNT162b1 , BNT162b2 and BNT162c2 vaccination mediated 
a potent T -cell response demonstrated by overall increased T -cell numbers, 
expression of molecules related to T -cell activation  and the production of effector 
cytokines. Mainly  BNT162b1 and BNT162b2 mediated a T FH response in the dLNs , B 
cell proliferation , and the generation of significant numbers of plasma B cells and 
germinal center B cells undergoing Ig class switc h and affinity maturation .  
5.3 Cytokine M ultiplex Assay  
Complimentary to the analysis of cytokine secretion by IFNγ ELISpot and flow 
cytometry, sple en and LN cells were restimulated for 48 h  with S peptide mixes or 
without peptide , and the release of cytokines quantified by a bead -based multiplex 
assay. Buffer treated animals served as control group. Unstimulated samples (cell 
culture medium) were compared to S peptide restimulated samples and P -values were 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709088
  
 
R&D Report R -20-0112  Version 01  Page 60 of 105 
  Strictly Confidential  
determined by  two-way ANOVA and Sidak's multiple comparisons test . Detection 
ranges are provided in Table  20. Raw data including tissues and cytokines not shown 
in Figure  13 can be found in  Table  21 to  
Table  32. 
Significant  antigen -specific  release of the T H1 cytokines IFNγ and IL -2 was observed 
in the BNT162b1, BNT162b2 and BNT162c2  vaccinated groups ( Figure  13a). 
Splenocyte s from BNT162a1 treated mice mediated a significan t IL-2 response and a 
weak IFNγ release in three of eight mice. Highest response s for both cytokines  
surpassing the upper limit of quantification for IFNγ  were found in the BNT162b2 and 
BNT162c2  groups encoding the full -length S protein. Comparably weak or  no secretion 
of the T H2 cytokines IL -4 and IL -5 was measured  (Figure  13b). Low but significant 
release of IL -4 and IL -5 was shown for BNT162b2 and BNT162c2 . IL-4 but not IL -5 
was detected in the supernatant of sple nocytes from BNT162b1  vaccinated  mice. 
Besides T H1 cytokines, high amounts of proinflammatory IL -18 were released in the 
BNT162b2 and BNT162c2  vaccinated groups , and to lesser extent in the BNT162b 1 
and BNT162 a1 vaccinated groups ( Figure  13c). Additional proinflammatory cytokines 
were significantly elevated , such as GM -CSF (Figure  13d) or IL -6 (not shown) , 
particularly in the  BNT162b1, BNT162b2 and BNT162c2  vaccinated groups .  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709089
  
 
R&D Report R -20-0112  Version 01  Page 61 of 105 
  Strictly Confidential  
 
Figure 13: Quantification of cytokine secreti on upon S peptide restimulation of splenocytes  of BNT162a1, 
BNT162b1, BNT162b2 or BNT162c2  vaccinated mice  
Cytokine multiplex  analysis of supernatants of splenocytes upon S peptide restimulation. Splenocytes of BNT162a1, 
BNT162b1, BNT162b2 or BNT162c2  vaccinated  mice ( N=8 per group)  were isolated on day 12 (BNT162a1, 
BNT162b1, BNT162b2) or day 27 (BNT162c2) after  vaccination . Splenocytes of buffer treated mice (N=3) served 
as control.  Dots indicate individual values,  group mean values are indicated by bars , horizontal d otted  lines indicate 
the upper limit of detection (ULOQ). Values below the lower limit of quantification (LLOQ) were set to zero. Values 
above the upper limit of quantifi cation (ULOQ) were set to the ULOQ.  
5.4 xCELLigence Cytotoxicity Assay   
Isolated CD8+ splenocytes were probed for the ir capacity to kill CT26 cells 
electroporated with S RNA  (mCorVac#15) and additionally pulsed with S peptide  mixes  
(mCorVac#16) . CD8+ T cells stimulated with CT26 cells electroporated  with irrelevant 
RNA served as negative control. Complete tumor cell lysis was modeled by addition of 
Staurosporin to the S  RNA electroporated or S peptide mix loaded  CT26 cells. Raw 
data can be found in Attachment III. 
In line with weak antigen -specific cytokine release ( Figure  6, Figure  12, Figure  13), no 
relevant CT26 cell lysis was observed in the BNT162a1 group. For the BNT162b1  
vaccinated group,  a tendency for cell killing was observed in four out of eight mice  (3-
2, 3-3, 3-4 and 3 -6) given that the Normalized Cell Index of CT26 cells electroporated 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709090
  
 
R&D Report R -20-0112  Version 01  Page 62 of 105 
  Strictly Confidential  
with irrelevant RNA was higher than for S  RNA  electroporate d cells ( Figure  14). More 
pronounced tumor cell lysis  in eight out of eight mice  was observed for splenocytes of 
mice vaccinated with BNT162b2 or BNT162c2 , which  encod e the full -length S protein 
(Figure  15). Overall , the  detected effects were rather weak and warrant  further  
optimization of the assay. No quantitative and statistical analysis of this dataset was 
performed.  
 
Figure 14: Cytotoxicity towards S protein expressing CT26 cells by CD8+ splenocytes from BNT162a1 or 
BNT162b1 vaccinated mice  (mCorVAC#15) . 
Splenocytes of BNT162a1 or BNT162b1 vaccinated mice ( N=8 per group)  were cultured over night with S peptide 
and recombinant IL -2 and subsequently CD8+ cells were isolated via magnetic bead based separation (MACS). 
CT26 cells electroporated with S RNA or irrelevant RNA were cult ured in xCELL igence plates for 24 h prior to 
addition of isolated CD8+ T cells . CT26 cell numbers  were quantified via impedance measurement (Normalized Cell 
Index, higher values indicate more viable CT26 cells, normalization was performed at the time point of T cell 
addition). Staurosporin treatment modeled complete tumor cell lysis. CT26 cells transfected wi th irrelevant RNA 
served as negative control. Depicted is the Normalized Cell Index over time for individual mice.  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709091
  
 
R&D Report R -20-0112  Version 01  Page 63 of 105 
  Strictly Confidential  
 
Figure 15: Cytotoxicity towards S protein expressing CT26 cells by CD8+ splenocytes from BNT162b2 or 
BNT162c2 vac cinated mice  (mCorVAC#16).  
Splenocytes of BNT162b2 or BNT162c2 vaccinated mice ( N=8 per group)  were cultured over night with S peptide 
and recombinant IL -2 and subsequently CD8+ cells were isolated via magnetic bead based separation (MACS). 
CT26 cells elec troporated with S  RNA or irrelevant RNA were cult ured in xCELLigence plates for 24 h . Prior to 
addition of isolated CD8+ T cells , S RNA transfected CT26 cells were pulsed with S peptide . CT26 cell numbers  
were quantified via impedance measurement (Normaliz ed Cell Index, higher values indicate more viable CT26 cells, 
normalization was performed at the time point of T cell addition). Staurosporin treatment modeled complete tumor 
cell lysis. CT26 cells transfected with irrelevant RNA served as negative control . Depicted is the Normalized Cell 
Index over time for individual mice.   
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709092
  
 
R&D Report R -20-0112  Version 01  Page 64 of 105 
  Strictly Confidential  
6 CONCLUSION  
This study aimed at characterizing T - and B -cell responses induced by the COVID -19 
vaccine candidates BNT162a1, BNT162b2 , BNT162b1  and BNT162c2  in detail.  
Overall, the r esults of the different assay types pointed towards similar conclusions , 
highlighting the validity of the obtained data. IFNγ ELISpot  assay , flow cytometry  
analysis  and multiplexed quantification of cytokines suggested that particularly 
BNT162b1 , BNT162b2 and BNT162c2 vaccination induced  a potent T -cell response 
demonstrated  by overall increased T -cell numbers, expression of molecules related to 
T-cell activation and the potential of T cells to produce cytokines.  T-cell responses 
showed primarily a T H1 phen otype with increased numbers of T -bet+ CD4+ T cells 
(mainly BNT162b1 and BNT162b2) and high secretion of T H1 type cytokines (IFNγ, IL -
2, TNF) and low secretion of T H2 type cytokines (IL -4, IL-5). Mainly BNT162b1 and 
BNT162b2 mediated a T FH response in the dLNs , B cell proliferation and the generation 
of significant numbers of antibody producing plasma B cells a nd germinal center B 
cells unde rgoing Ig  class switch and affinity maturation.   
The results of this stu dy are in agreement with prior studies  investigating the number  
of IFNγ specific T cells by ELISpot and IgG titers by ELISA 28 days after vaccination  
(R-20-0040, R -20-0042, R -20-0053, R -20-0085) . Similarly to this study, responses of 
BNT162b1 and BNT162b2 were much stronger compared to BNT162a1  in those 
studies . 
Since the kinetics of expression for the vaccine encoded protein of BNT16 2c2 differ s 
from the o ther three vaccine candidates , the analysis time point was set on  day 27 
instead of day 12 after vaccination . It is possible  that the selected time point was 
suboptimal and missed the peak expansion of lymphocytes . BNT162c2 induced a 
potent T -cell response  (IFNγ ELISpot, intracellular cytokine staining by flow cytometry 
and multiplexed protein quantification) including the highest T FH cell responses 
amongst all tested candidates in the blood on day 7 after treatment. However, in the 
dLNs on day 27 after vac cination , the impact on T FH cells and B cells was weak to 
undetectable. Effects of BNT162c2 on both T and B cells might be stronger when 
analyzed at an earlier time point. Direct comparison of BNT162c2 to BNT162a1, 
BNT162b2  or BNT162b1  is therefore difficu lt and might underestimate the potential of 
BNT162c2.  
Due to the prominent induction of both T - and B -cell responses, these results 
particularly support further clinical evaluation of the COVID -19 vaccine candidates 
BNT162b1 and BNT162b2  and warrant furth er evaluation of BNT162c2 .  
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709093
  
 
R&D Report R -20-0112  Version 01  Page 65 of 105 
  Strictly Confidential  
7 DOCUMENT HISTORY  
First version / no change.  
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709094
  
 
R&D Report R -20-0112  Version 01  Page 66 of 105 
  Strictly Confidential  
8 REFERENCES  
Song Z, Xu Y, Bao L, Zhang L, Yu P, Qu Y, et al. From SARS to MERS, Thrusting 
Coronaviruses into the Spotlight. Viruses. 2019;11(1).  
Vogel AB, Lambert L, Kinnear E, Bus se D, Erbar S, Reuter KC, et al. Self-Amplifying 
RNA Vaccines Give Equivalent Protection against Influenza to mRNA Vaccines but at 
Much Lower Doses. Mol Ther [Internet]. 2018;26(2):446 –55. Available from: 
https://doi.org/10.1016/j.ymthe.2017.11.017  
Pardi N , Hogan MJ, Pelc RS, Muramatsu H, Andersen H, DeMaso CR, et al. Zika virus 
protection by a single low -dose nucleoside -modified mRNA vaccination. Nature. 
2017;543(7644):248 –51.  
Moyo N, Vogel AB, Buus S, Erbar S, Wee EG, Sahin U, et al. Efficient Induction of T 
Cells against Conserved HIV -1 Regions by Mosaic Vaccines Delivered as Self -
Amplifying mRNA. Mol Ther Methods Clin Dev. 2019 Mar 15;12:32 –46.  
Harrell MI, Iritani BM, Ruddell A. Lymph node mapping in the mouse. J Immunol 
Methods. 2008;332(1 –2):170 –4.  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709095
  
 
R&D Report R -20-0112  Version 01  Page 67 of 105 
  Strictly Confidential  
9 APPENDIX  
9.1 Animal Monitoring  
9.2 Animal Monitoring - Observations  
Table 14: Parameters for experimental animal monitoring (single animal assessment)  
The table is separated in immediate euthanasia  criteria  (end of experiment ) and criteria , which , solitarily observed , do not lead to an immediate termination , but result in  higher  
monitoring frequency of re-assessment . BCS, body conditioning score.  
  Observation (if applicable, categorize a): 
Code Parameter  Renew assessment within <  24 h. Attention: 
evaluate accumulated parameters  Immediate euthanasia criteria  
1 Bodyweight b. Take into account 
BCS c Body weight loss >5 –10%, or BCS transition 3 to 2 Body  weight loss >15 -20%, or BCS 2  
2 Activity  Moderate deviation from normal or unusual 
beha vior (e.g. limited, reduced or hyperactive 
movements)  Immobility, very slow movements (high grade of 
lethargy), self -isolation  
3 Appearance (condition) of fur & 
eyes  Fur defects/ grooming malfunction (reduced or 
exaggerated grooming). Moderate orbital 
tightening.  Distinct scruffy fur, s trongly neglected grooming. Eye  lids 
narrowed, eyes closed and sticky.  
4 Body cavities & body fluids  Slight to moderate damp & sticky cavities  Clinical signs of disease (diarrhea, distinct sticky)  
5 Body temperature & blo od 
circulation ears  - Body  temperature low, ears appear white and hardly 
noticeable blood vessels  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709096
  
 
R&D Report R -20-0112  Version 01  Page 68 of 105 
  Strictly Confidential  
  Observation (if applicable, categorize a): 
Code Parameter  Renew assessment within <  24 h. Attention: 
evaluate accumulated parameters  Immediate euthanasia criteria  
6 Posture  Moderate deviation of normal physiological 
posture i.e., short pause in hunched posture  Abnormal posture, hunched, abnormally stretched (belly 
touches ground) or cramps  
7 Reaction to stimulus  d Delayed reaction to unconditioned stimulus, 
moderate deviation from normal behavior (e.g. 
slight  to moderate apathy)  Abnormal (distinct delayed reaction to unconditioned 
stimulus). Winding and enduring sound utterance 
("pain"), aggressiveness to touch  
8 Automutilation   - Noticable b urden , i.e. missing extremities, continuous 
nibbling, biting and gnawing, open wounds  
9 Bites (tail, vibrissae, reproductive 
organs…), other wounds  Open and bleeding wounds (take care of wounds 
and separate from others ) Noticable b urden , i.e. inflamed wounds  
10 Respiration frequency  Moderate deviation of spontaneous breathing 
(normal respiration frequency)  High frequency, any sign of dyspnea, gasping, flat 
stretched posture in com bination with strongly retracting 
flanks  
11 Motor function  Weak, loose grip (cage grid)  Staggering, circular movement, missing grasp  
12 Other abnormalities e  -  - 
a Categories : NAD, no abnormality detected; +, slight; ++, moderate; +++, distinct.  
b Calculate ratio bodyweight start of experiment/ bodyweight monitoring day.  
c According to  Ullman -Culleré and Foltz 1999 . 
d Unconditioned = Stimulus to force a reaction e.g. normal background noise, tapping the cage a nd normal handling procedure e.g. tilt and turns of the cage.  
e Description of abnormality (or abnormalities) on monitoring sheet.  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709097
  
 
R&D Report R -20-0112  Version 01  Page 69 of 105 
  Strictly Confidential  
Table 15: Record of  body weights of mCorVAC#15  animals during study  
 
Cage Mouse ID Strain Gender Date of birth Treatment Day 0 Day 1 Day 2 Day 3 Day 4 Day 5 Day 7
SBIO-15337 BIO-LO78 BALB/cJRj f 03.03.20 1 20.4 20.3 20.5 20.6 20.3 20.8 20.6
SBIO-15337 BIO-LO79 BALB/cJRj f 03.03.20 1 22.1 22.6 22.5 22.3 22.4 23.5 22.7
SBIO-15337 BIO-LO80 BALB/cJRj f 03.03.20 1 20.9 21.1 20.9 20.8 20.9 21.6 21.3
SBIO-15337 BIO-LO81 BALB/cJRj f 03.03.20 1 21.7 21.5 21.4 21.0 21.2 22.5 22.1
SBIO-15338 BIO-LO82 BALB/cJRj f 03.03.20 1 19.6 19.8 20.2 20.4 20.7 20.5 21.2
SBIO-15338 BIO-LO83 BALB/cJRj f 03.03.20 1 20.9 20.7 21.2 21.0 21.6 20.9 21.3
SBIO-15338 BIO-LO84 BALB/cJRj f 03.03.20 1 19.7 19.5 19.5 19.3 19.9 20.3 19.9
SBIO-15338 BIO-LO85 BALB/cJRj f 03.03.20 1 18.9 18.6 18.3 18.4 19.0 18.9 18.9
SBIO-15339 BIO-LO86 BALB/cJRj f 03.03.20 2 20.9 20.6 20.9 21.2 20.8 21.1 21.2
SBIO-15339 BIO-LO87 BALB/cJRj f 03.03.20 2 21.3 19.3 20.2 22.7 21.4 21.1 20.7
SBIO-15339 BIO-LO88 BALB/cJRj f 03.03.20 2 23.2 20.5 21.9 22.5 22.4 22.9 22.9
SBIO-15339 BIO-LO89 BALB/cJRj f 03.03.20 2 19.8 18.9 20.0 20.8 20.3 21.0 20.7
SBIO-15340 BIO-LO90 BALB/cJRj f 03.03.20 2 22.5 20.9 21.3 21.7 21.6 21.7 21.6
SBIO-15340 BIO-LO91 BALB/cJRj f 03.03.20 2 20.9 19.2 20.6 21.6 20.8 20.8 20.9
SBIO-15340 BIO-LO92 BALB/cJRj f 03.03.20 2 21.8 21.1 21.5 22.1 21.8 21.5 22.1
SBIO-15340 BIO-LO93 BALB/cJRj f 03.03.20 2 22.7 20.6 21.8 22.5 22.5 22.2 22.8
SBIO-15341 BIO-LO94 BALB/cJRj f 03.03.20 3 19.3 18.2 18.9 19.0 18.9 18.9 18.9
SBIO-15341 BIO-LO95 BALB/cJRj f 03.03.20 3 21.1 21.6 20.6 21.1 21.2 21.9 21.1
SBIO-15341 BIO-LO96 BALB/cJRj f 03.03.20 3 20.3 19.3 20.2 20.5 20.8 20.3 20.2
SBIO-15341 BIO-LO97 BALB/cJRj f 03.03.20 3 22.9 22.0 23.0 23.4 23.3 22.9 22.3
SBIO-15342 BIO-LO98 BALB/cJRj f 03.03.20 3 21.1 21.0 21.7 21.7 22.6 23.1 23.3
SBIO-15342 BIO-LO99 BALB/cJRj f 03.03.20 3 19.9 18.9 19.3 19.7 19.2 19.9 19.2
SBIO-15342 BIO-LP00 BALB/cJRj f 03.03.20 3 22.1 21.0 22.3 22.3 20.8 22.1 21.9
SBIO-15342 BIO-LP01 BALB/cJRj f 03.03.20 3 20.6 19.8 21.1 21.4 22.1 21.1 21.3Bodyweight (grams)
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709098
  
 
R&D Report R -20-0112  Version 01  Page 70 of 105 
  Strictly Confidential  
Table 16: Record of animal monitoring during CorVac#15 study 
12: swelling of injection site muscle  
 
Cage Mouse ID Strain Gender Date of birth Treatment Day 0 Day 1 Day 2 Day 3 Day 4 Day 5 Day 7
SBIO-15337 BIO-LO78 BALB/cJRj f 03.03.20 1 NAD NAD NAD NAD NAD NAD NAD
SBIO-15337 BIO-LO79 BALB/cJRj f 03.03.20 1 NAD NAD NAD NAD NAD NAD NAD
SBIO-15337 BIO-LO80 BALB/cJRj f 03.03.20 1 NAD NAD NAD NAD NAD NAD NAD
SBIO-15337 BIO-LO81 BALB/cJRj f 03.03.20 1 NAD NAD NAD NAD NAD NAD NAD
SBIO-15338 BIO-LO82 BALB/cJRj f 03.03.20 1 NAD NAD NAD NAD NAD NAD NAD
SBIO-15338 BIO-LO83 BALB/cJRj f 03.03.20 1 NAD NAD NAD NAD NAD NAD NAD
SBIO-15338 BIO-LO84 BALB/cJRj f 03.03.20 1 NAD NAD NAD NAD NAD NAD NAD
SBIO-15338 BIO-LO85 BALB/cJRj f 03.03.20 1 NAD NAD NAD NAD NAD NAD NAD
SBIO-15339 BIO-LO86 BALB/cJRj f 03.03.20 2 NAD 3+;12+ 12+ NAD 12+ NAD NAD
SBIO-15339 BIO-LO87 BALB/cJRj f 03.03.20 2 NAD 3+;12++ 12++ NAD 12+ NAD NAD
SBIO-15339 BIO-LO88 BALB/cJRj f 03.03.20 2 NAD 3+;12++ 12++ 12+ NAD NAD NAD
SBIO-15339 BIO-LO89 BALB/cJRj f 03.03.20 2 NAD 3+;12+ 12+ 12+ NAD NAD NAD
SBIO-15340 BIO-LO90 BALB/cJRj f 03.03.20 2 NAD 3+;12++ 12++ NAD 12+ NAD NAD
SBIO-15340 BIO-LO91 BALB/cJRj f 03.03.20 2 NAD 3+;12++ 12++ NAD 12+ NAD NAD
SBIO-15340 BIO-LO92 BALB/cJRj f 03.03.20 2 NAD 3+;12++ 12++ 12+ 12+ NAD NAD
SBIO-15340 BIO-LO93 BALB/cJRj f 03.03.20 2 NAD 3+;12++ 12++ 12+ NAD NAD NAD
SBIO-15341 BIO-LO94 BALB/cJRj f 03.03.20 3 NAD 3+;12+ 12+ NAD NAD NAD NAD
SBIO-15341 BIO-LO95 BALB/cJRj f 03.03.20 3 NAD 3+;12+ 12+ NAD NAD NAD NAD
SBIO-15341 BIO-LO96 BALB/cJRj f 03.03.20 3 NAD 3+;12++ 12++ 12+ NAD NAD NAD
SBIO-15341 BIO-LO97 BALB/cJRj f 03.03.20 3 NAD 3+;12++ 12+ NAD NAD NAD NAD
SBIO-15342 BIO-LO98 BALB/cJRj f 03.03.20 3 NAD 3+;12++ 12++ NAD NAD NAD NAD
SBIO-15342 BIO-LO99 BALB/cJRj f 03.03.20 3 NAD 3+;12++ 12++ 12+ NAD NAD NAD
SBIO-15342 BIO-LP00 BALB/cJRj f 03.03.20 3 NAD 3+;12++ 12++ 12++ 12+ NAD NAD
SBIO-15342 BIO-LP01 BALB/cJRj f 03.03.20 3 NAD 3+;12++ 12+ 12+ NAD NAD NADAnimal Monitoring - Observations
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709099
  
 
R&D Report R -20-0112  Version 01  Page 71 of 105 
  Strictly Confidential  
Table 17: Record of  body weights of CorVac#16 animals during study  
n/a: not available ( Treatment group 1+2: no weight measurement performe d as treatment had just occurred [day 15] ; Treatment group 3: Weekly weight measurement sufficient ) 
 
Cage Mouse ID Strain Gender Date of birth Treatment Day 0 Day 1 Day 2 Day 3 Day 4 Day 5 Day 7 Day 15 Day 16 Day 17 Day 18 Day 19 Day 22
SBIO-15337 BIO-LO78 BALB/cJRj f 03 03 20 1 n/a n/a n/a n/a n/a n/a n/a 21.1 20.8 20.8 21.1 21.5 21.0
SBIO-15337 BIO-LO79 BALB/cJRj f 03 03 20 1 n/a n/a n/a n/a n/a n/a n/a 21.3 21.2 20.9 21 0 21.9 21.9
SBIO-15337 BIO-LO80 BALB/cJRj f 03 03 20 1 n/a n/a n/a n/a n/a n/a n/a 20.0 20.2 20.2 20 3 21.2 20.7
SBIO-15337 BIO-LO81 BALB/cJRj f 03 03 20 1 n/a n/a n/a n/a n/a n/a n/a 22.5 22.4 21.9 21 9 23.1 22.7
SBIO-15338 BIO-LO82 BALB/cJRj f 03 03 20 1 n/a n/a n/a n/a n/a n/a n/a 21.9 22.4 22.3 22.1 22.1 22.6
SBIO-15338 BIO-LO83 BALB/cJRj f 03 03 20 1 n/a n/a n/a n/a n/a n/a n/a 20.2 20.5 20.6 20.6 20.7 21.1
SBIO-15338 BIO-LO84 BALB/cJRj f 03 03 20 1 n/a n/a n/a n/a n/a n/a n/a 20.5 21.1 20.8 21 2 21.7 20.8
SBIO-15338 BIO-LO85 BALB/cJRj f 03 03 20 1 n/a n/a n/a n/a n/a n/a n/a 21.9 22.6 22.3 21 9 22.6 22.3
SBIO-15339 BIO-LO86 BALB/cJRj f 03 03 20 2 n/a n/a n/a n/a n/a n/a n/a 22.5 21.7 22.6 23 2 22.9 23.1
SBIO-15339 BIO-LO87 BALB/cJRj f 03 03 20 2 n/a n/a n/a n/a n/a n/a n/a 22.1 21.3 21.9 22 5 23.2 22.1
SBIO-15339 BIO-LO88 BALB/cJRj f 03 03 20 2 n/a n/a n/a n/a n/a n/a n/a 21.7 20.9 21.6 21.6 22.2 22.1
SBIO-15339 BIO-LO89 BALB/cJRj f 03 03 20 2 n/a n/a n/a n/a n/a n/a n/a 21.5 21.2 22.6 22.7 23.2 22.7
SBIO-15340 BIO-LO90 BALB/cJRj f 03 03 20 2 n/a n/a n/a n/a n/a n/a n/a 21.9 20.3 20.5 21.1 21.4 21.1
SBIO-15340 BIO-LO91 BALB/cJRj f 03 03 20 2 n/a n/a n/a n/a n/a n/a n/a 21.1 20.3 20.4 22.7 21.1 20.6
SBIO-15340 BIO-LO92 BALB/cJRj f 03 03 20 2 n/a n/a n/a n/a n/a n/a n/a 22.4 21.7 23.9 23 8 23.8 22.5
SBIO-15340 BIO-LO93 BALB/cJRj f 03 03 20 2 n/a n/a n/a n/a n/a n/a n/a 23.3 21.7 22.4 20 9 22.7 22.2
SBIO-15341 BIO-LO94 BALB/cJRj f 03 03 20 3 21 8 20.8 21 5 22.1 21.9 22.1 22.1 n/a 23.4 n/a n/a n/a 22.8
SBIO-15341 BIO-LO95 BALB/cJRj f 03 03 20 3 20 8 19.3 20 3 21.2 20.6 21.1 21.5 n/a 21.7 n/a n/a n/a 22.1
SBIO-15341 BIO-LO96 BALB/cJRj f 03 03 20 3 22.4 20.1 21.4 22.5 22.1 22.2 22.1 n/a 23.3 n/a n/a n/a 22.8
SBIO-15341 BIO-LO97 BALB/cJRj f 03 03 20 3 19.1 17.6 17 8 19.1 18.5 19.4 20.5 n/a 19.5 n/a n/a n/a 19
SBIO-15342 BIO-LO98 BALB/cJRj f 03 03 20 3 18.7 17.2 18 0 18.6 18.5 18.8 18.2 n/a 20.1 n/a n/a n/a 20.6
SBIO-15342 BIO-LO99 BALB/cJRj f 03 03 20 3 20 5 19.2 20.4 21.2 21.1 21.7 20.9 n/a 22.1 n/a n/a n/a 21.5
SBIO-15342 BIO-LP00 BALB/cJRj f 03 03 20 3 19.6 17.6 19.1 19.8 19.9 19.9 19.9 n/a 22.3 n/a n/a n/a 22.8
SBIO-15342 BIO-LP01 BALB/cJRj f 03 03 20 3 18.1 16.8 17.4 17.9 18.2 18.2 18.1 n/a 19.8 n/a n/a n/a 19Bodyweight (grams)
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709100
  
 
R&D Report R -20-0112  Version 01  Page 72 of 105 
  Strictly Confidential  
Table 18: Record of animal monitoring during CorVac#16 study  
12: swelling of injection site muscle  
n/a: not available (no weight m easurement performed as treatment had just occurred [day 15])  
 
Cage Mouse ID Strain Gender Date of birth Treatment Day 0 Day 1 Day 2 Day 3 Day 4 Day 5 Day 7 Day 15 Day 16 Day 17 Day 18 Day 19 Day 22
SBIO-15337 BIO-LO78 BALB/cJRj f 03.03.20 1 n/a n/a n/a n/a n/a n/a n/a NAD NAD NAD NAD NAD NAD
SBIO-15337 BIO-LO79 BALB/cJRj f 03.03.20 1 n/a n/a n/a n/a n/a n/a n/a NAD NAD NAD NAD NAD NAD
SBIO-15337 BIO-LO80 BALB/cJRj f 03.03.20 1 n/a n/a n/a n/a n/a n/a n/a NAD NAD NAD NAD NAD NAD
SBIO-15337 BIO-LO81 BALB/cJRj f 03.03.20 1 n/a n/a n/a n/a n/a n/a n/a NAD NAD NAD NAD NAD NAD
SBIO-15338 BIO-LO82 BALB/cJRj f 03.03.20 1 n/a n/a n/a n/a n/a n/a n/a NAD NAD NAD NAD NAD NAD
SBIO-15338 BIO-LO83 BALB/cJRj f 03.03.20 1 n/a n/a n/a n/a n/a n/a n/a NAD NAD NAD NAD NAD NAD
SBIO-15338 BIO-LO84 BALB/cJRj f 03.03.20 1 n/a n/a n/a n/a n/a n/a n/a NAD NAD NAD NAD NAD NAD
SBIO-15338 BIO-LO85 BALB/cJRj f 03.03.20 1 n/a n/a n/a n/a n/a n/a n/a NAD NAD NAD NAD NAD NAD
SBIO-15339 BIO-LO86 BALB/cJRj f 03.03.20 2 n/a n/a n/a n/a n/a n/a n/a NAD 12+ 12+ NAD NAD NAD
SBIO-15339 BIO-LO87 BALB/cJRj f 03.03.20 2 n/a n/a n/a n/a n/a n/a n/a NAD 12++ 12++ 12+ NAD NAD
SBIO-15339 BIO-LO88 BALB/cJRj f 03.03.20 2 n/a n/a n/a n/a n/a n/a n/a NAD 12++ 12+ NAD NAD NAD
SBIO-15339 BIO-LO89 BALB/cJRj f 03.03.20 2 n/a n/a n/a n/a n/a n/a n/a NAD 12++ 12+ NAD NAD NAD
SBIO-15340 BIO-LO90 BALB/cJRj f 03.03.20 2 n/a n/a n/a n/a n/a n/a n/a NAD 12++ 12+ 12+ NAD NAD
SBIO-15340 BIO-LO91 BALB/cJRj f 03.03.20 2 n/a n/a n/a n/a n/a n/a n/a NAD 12++ 12++ NAD NAD NAD
SBIO-15340 BIO-LO92 BALB/cJRj f 03.03.20 2 n/a n/a n/a n/a n/a n/a n/a NAD 12+ 12+ NAD NAD NAD
SBIO-15340 BIO-LO93 BALB/cJRj f 03.03.20 2 n/a n/a n/a n/a n/a n/a n/a NAD 12++ 12++ 12+ NAD NAD
SBIO-15341 BIO-LO94 BALB/cJRj f 03.03.20 3 NAD 3++;12++ 3++;12++ 3++;3++ 12++ 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15341 BIO-LO95 BALB/cJRj f 03.03.20 3 NAD 3++;12+++ 3+;12++ 3+; 12+ 12+ NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15341 BIO-LO96 BALB/cJRj f 03.03.20 3 NAD 3++;12++ 3+;12++ 3+;12+ 12+ NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15341 BIO-LO97 BALB/cJRj f 03.03.20 3 NAD 3++;12+++ 3++;12++ 3+; 12++ 12++ 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15342 BIO-LO98 BALB/cJRj f 03.03.20 3 NAD 3+;12++ 12++ 12+ 12+ NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15342 BIO-LO99 BALB/cJRj f 03.03.20 3 NAD 3+;12++ 12++ 12+ 12++ 12+ NAD NAD NAD NAD NAD NAD NAD
SBIO-15342 BIO-LP00 BALB/cJRj f 03.03.20 3 NAD 3+;12++ 12++ NAD 12+ NAD NAD NAD NAD NAD NAD NAD NAD
SBIO-15342 BIO-LP01 BALB/cJRj f 03.03.20 3 NAD 3++;12+++ 3+;12+++ 3+;12+ 12++ 12+ NAD NAD NAD NAD NAD NAD NADAnimal Monitoring - Observations
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709101
  
 
R&D Report R -20-0112  Version 01  Page 73 of 105 
  Strictly Confidential  
9.3 ELISpot – Raw data  
Table 19: ELISpot raw data.   
TNTC, too numerous to count (these values are set to 1 ,500 in Figure  6). Thousa nds were not separated by commas.  
  Stimulation (well 1 | well 2)  
Group Mouse No peptide  S peptide  Control RNA  S RNA 
 
Control 
(mCorVac#15)  1 2 1 4 3 0 1 3 1 
2 3 2 2 2 6 11 2 1 
3 3 1 8 11 7 3 6 3 
4 5 6 6 4 2 4 3 4 
5 6 4 11 15 5 9 6 3 
6 6 5 9 13 5 7 4 5 
7 3 5 8 14 12 14 11 6 
8 8 4 18 15 5 6 4 1 
BNT162a1  
 1 13 13 118 127 7 6 57 63 
2 12 9 128 148 12 7 98 101 
3 23 17 75 86 5 9 39 40 
4 14 21 51 48 5 5 38 34 
5 20 18 87 107 13 9 43 51 
6 17 23 132 156 11 22 48 84 
7 15 14 69 65 7 3 38 41 
8 18 42 96 121 13 18 64 67 
 
BNT162b1  
 1 42 44 658 645 19 21 676 615 
2 11 16 456 440 21 14 399 322 
3 21 23 889 977 8 9 1124  1218  
4 26 21 871 918 11 12 779 751 
5 22 26 873 834 15 9 841 881 
6 33 16 733 746 12 12 758 842 
7 16 24 861 837 16 11 825 702 
8 17 18 837 772 9 8 628 598 
Control 
(mCorVac#16 ) 
 1 21 9 7 57 12 11 8 11 
2 4 15 7 28 28 31 18 16 
3 13 5 12 23 11 7 6 9 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709102
  
 
R&D Report R -20-0112  Version 01  Page 74 of 105 
  Strictly Confidential  
  Stimulation (well 1 | well 2)  
Group Mouse No peptide  S peptide  Control RNA  S RNA 
4 19 19 26 38 4 9 6 7 
5 8 9 19 31 8 8 7 2 
6 22 13 26 28 19 12 11 17 
7 17 15 21 24 17 20 12 13 
8 14 11 37 62 12 15 16 26 
BNT162b2  1 6 14 1267  1296  13 13 1674  1628  
2 20 17 1196  1147  15 20 1281  1268  
3 17 20 1503  1404  39 37 1278  1117  
4 11 13 1311  1289  20 17 1226  1324  
5 21 21 911 881 23 12 1171  1391  
6 15 25 1126  1173  11 13 1143  1427  
7 9 14 1128  1096  15 16 1435  1334  
8 33 24 TNTC  TNTC  59 62 TNTC  TNTC  
BNT162c2  
 1 7 6 1315  1328  9 18 1348  1263  
2 11 13 1315  1328  24 4 1222  1089  
3 7 5 1328  1267  12 14 1351  1206  
4 21 16 877 1135  24 15 1188  1173  
5 12 9 1371  1199  19 11 1504  1246  
6 6 14 1025  786 5 20 1143  1232  
7 11 15 1218  1132  21 22 1034  911 
8 4 6 1275  1054  13 6 973 1092  
 
 
 
  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709103
  
 
R&D Report R -20-0112  Version 01  Page 75 of 105 
  Strictly Confidential  
9.4 Cytokine multiplex analysis – Assay d etection ranges  
Table 20: Detection ranges of the ProcartaPlex immuno assay for mCorVAC #15 and mCorVAC #16.  
Depicted are lower limt of quantification (LLOQ) and upper limit of quantification (ULOQ) for each analyte.  LN, lymph node. SP, spleen.  
[pg/mL] IFNγ IL-12p70 IL-13 IL-1β IL-2 IL-4 IL-5 IL-6 TNFα GM-CSF IL-18 
mCorVAC #15 
(SP, LN)  1.1-4,800  1.5-409.3  2.1-8,650  1-4,350  1.2-5,250  4.8-4,950  1.9-8,000  4.7-19,500  2.8-731.2  2.4-9,950  50.5-207,000  
mCorVAC #16 
Plate 1  (SP) 1.1-4,800  1.5-102.3  2.1-2,162.5   1-1,087.5    1.2-1,312.5   1.2-4,950   7.8-2,000  4.7-4,875   2.8-731.2  9.7-2,487.5  202.1 -51,750   
mCorVAC #16 
Plate 2 (LN)  1.1-4,800 1.5-102.3  2.1-8,650  1-4,350  1.2-5,250  1.2-4,950  1.9-8,000  4.7-19,500  2.8-731.2  2.4-9,950  202.1 -51,750   
 
 
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709104
  
 
R&D Report R -20-0112  Version 01  Page 76 of 105 
  Strictly Confidential  
9.5 Cytokine multiplex analysis – Raw data and calculated data  
Table 21: Cytokine raw data and calculated data for mCorVAC#15 , part 1 of 6 (SP) 
Acquired MFI values (MFI) were converted into concentrations by ProcartaPlex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification (<LLOQ, blue)) are set to zero.  Values above the upper limit of quantification (>ULOQ, red) are set to the ULOQ. Commas are used as decimal 
separators. Thousand were not separated by commas. Gr, group. M, mouse ID. SP, spleen.  
 
  
Sample 
IDGrMRestimulation Tissue MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL]
2 11 Medium SP 187,5 1,26 1,26 11 <=0 0 24 <=0 0 17 0,28 0 754 14,82 14,82
3 12 Medium SP 487 3,99 3,99 13 <=0 0 25 <=0 0 18 0,3 0 583 11,34 11,34
4 13 Medium SP 25 0,24 0 10 <=0 0 21 <=0 0 17 0,28 0 152 2,85 2,85
5 14 Medium SP 54 0,39 0 11 <=0 0 21,5 <=0 0 18 0,3 0 813,5 16,05 16,05
6 15 Medium SP 27 0,25 0 9 <=0 0 21 <=0 0 16 0,26 0 333 6,38 6,38
7 16 Medium SP 118 0,77 0 11 <=0 0 27 0,03 0 13 0,2 0 1012,5 20,24 20,24
8 17 Medium SP 46,5 0,35 0 11 <=0 0 59,5 1,34 0 14 0,22 0 915 18,17 18,17
9 18 Medium SP 124 0,81 0 10 <=0 0 28 0,07 0 12 0,18 0 737,5 14,48 14,48
10 21 Medium SP 1249,5 14,42 14,42 20 <=0 0 44 0,70 0 19 0,32 0 1778 37,67 37,67
11 22 Medium SP 165,5 1,10 1,10 14,5 <=0 0 41,5 0,60 0 15 0,24 0 539 10,45 10,45
12 23 Medium SP 219 1,51 1,51 13 <=0 0 30 0,14 0 21 0,36 0 406,5 7,82 7,82
13 24 Medium SP 50 0,37 0 11 <=0 0 33 0,26 0 16 0,26 0 470 9,08 9,08
14 25 Medium SP 2466 40,87 40,87 30 <=0 0 123 4,11 4,11 26 0,47 0 1123 22,62 22,62
15 26 Medium SP 455 3,66 3,66 12 <=0 0 62 1,44 0 16 0,26 0 730 14,32 14,32
16 27 Medium SP 162,5 1,08 0 12 <=0 0 28 0,07 017,5 0,29 0 1605 33,53 33,53
17 28 Medium SP 327 2,42 2,42 17 <=0 0 31 0,18 0 19 0,32 0 1560 32,47 32,47
18 31 Medium SP 2160,5 33,01 33,01 36 <=0 0 43 0,66 045,5 0,91 0 1498,5 31,04 31,04
19 32 Medium SP 446 3,57 3,57 15 <=0 0 33 0,26 0 18 0,30 0 1318 26,93 26,93
20 33 Medium SP 380,5 2,92 2,92 14 <=0 0 48 0,86 0 20 0,34 0 755 14,84 14,84
21 34 Medium SP 265 1,88 1,88 15 <=0 0 63 1,49 0 20 0,34 0 657,5 12,84 12,84
22 35 Medium SP 154 1,02 016,5 <=0 0 98,5 3,02 3,02 18 0,30 0 1112 22,38 22,38
23 36 Medium SP 128 0,84 0 12 <=0 0 46 0,78 0 15 0,24 0 1013 20,25 20,25
24 37 Medium SP 77 0,52 0 11 <=0 0 26 0,00 0 16 0,26 0 1116 22,47 22,47
25 38 Medium SP 347 2,61 2,61 14 <=0 0 115 3,75 3,75 18 0,30 0 902 17,90 17,90IFN-gamma IL-12p70 IL-13 IL-1beta IL-2
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709105
  
 
R&D Report R -20-0112  Version 01  Page 77 of 105 
  Strictly Confidential  
Table 22: Cytokine raw data and calculated data for mCorVAC#15 , part 2 of 6  (SP) 
Acquired MFI values (MFI) were converted into concentrations by ProcartaPlex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification  (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ, red) are  set to the ULOQ. Commas are used as decimal 
separators. Thousand were not separated by commas. Gr, group. M, mouse ID. SP, spleen .  
 
  
Sample 
IDGrMRestimulation Tissue MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL]
2 11 Medium SP 37 <=0 0 10 <=0 0 21 2,36 0 36 0,90 0 9 0,31 0 25 16,07 0
3 12 Medium SP 48 <=0 0 10 <=0 0 27 3,34 0 30 0,72 0 12 0,42 0 48 61,82 61,82
4 13 Medium SP 24 <=0 0 11 <=0 0 24,5 2,93 0 26 0,60 0 6 <=0 0 15 <=0 0
5 14 Medium SP 22 <=0 0 10 <=0 0 23 2,68 0 27 0,63 0 9 0,31 0 14,5 <=0 0
6 15 Medium SP 12 <=0 0 11 <=0 0 18 1,89 0 27 0,63 0 7 0,24 0 15 <=0 0
7 16 Medium SP 15 <=0 0 10 <=0 0 22,5 2,60 0 25 0,58 0 7 0,24 0 22 9,40 0
8 17 Medium SP 24 <=0 0 15 <=0 0 22 2,52 0 29 0,69 0 15,5 0,55 0 15 <=0 0
9 18 Medium SP 25 <=0 0 11 <=0 0 22 2,52 0 33 0,81 0 9,5 0,33 0 22 9,40 0
10 21 Medium SP 131,5 0,82 0 12 <=0 0 81 13 37 13,37 43 1,11 0 21 0,75 0 108 169,05 169,05
11 22 Medium SP 153 1,18 0 12,5 <=0 0 70 11,20 11,20 32 0,78 0 10 0,35 0 25 16,07 0
12 23 Medium SP 148 1,09 0 10 <=0 0 56,5 8,61 8,61 31 0,75 0 11 0,39 0 29 24,53 0
13 24 Medium SP 164 1,37 0 12 <=0 0 55 8 33 8,33 23 0,52 0 9 0,31 0 16 <=0 0
14 25 Medium SP 149 1,11 0 14,5 <=0 0413,5 92,66 92,66 909 35,52 35,52 24 0,85 0200,5 324,27 324,27
15 26 Medium SP 44 <=0 0 16,5 <=0 0 48 7,03 7,03 32 0,78 0 11 0,39 0 44 54,22 54,22
16 27 Medium SP 111 0,5 0 11 <=0 0 62 9,65 9,65 42,5 1,09 0 21 0,75 0 24 13,88 0
17 28 Medium SP 111 0,5 0 10 <=0 0 78 12,77 12,77 40 1,02 0 14 0,50 0 36 38,68 0
18 31 Medium SP 119 0,62 0 12 <=0 0 762 192,57 192,57 1697 77,07 77,07 27 0,96 0 189 305,29 305,29
19 32 Medium SP 83,5 0,11 0 12 <=0 0 59 9,08 9,08 40 1,02 0 22 0,78 0 44 54,22 54,22
20 33 Medium SP 303 4,01 0 11 <=0 0 99,5 17,13 17,13 36 0,90 0 17 0,60 0 39 44,57 0
21 34 Medium SP 275 3,44 0 12,5 <=0 0 157 29,48 29,48 32 0,78 0 13 0,46 0 32 30,67 0
22 35 Medium SP 385 5,72 5,72 29 0,43 0 154 28,82 28,82 33 0,81 0 13 0,46 0 26 18,22 0
23 36 Medium SP 153,5 1,19 0 16,5 <=0 0 107 18,68 18,68 28 0,66 0 15 0,53 0 22 9,40 0
24 37 Medium SP 77 0,03 0 11 <=0 0 45 6,48 6,48 23 0,52 0 11 0,39 0 16 <=0 0
25 38 Medium SP 195 1,92 0 10,5 <=0 0 137 25,08 25,08 38 0,96 0 24 0,85 0 37 40,65 0IL-18 IL-4 IL-5 IL-6 TNF-alpha GM-CSF
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709106
  
 
R&D Report R -20-0112  Version 01  Page 78 of 105 
  Strictly Confidential  
Table 23: Cytokine raw data and calculated data for mCorVAC#15 , part 3 of 6  (SP) 
Acquired MFI values (MFI) were converted into concentrations by ProcartaPlex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ, red) are  set to the ULOQ. Commas are used as decimal 
separators. Thousand were not separated by commas. Gr, group. M, mouse ID. PMAIono , PMA and Ionomycin (positive control). SP, spleen . 
  
Sample 
IDGrMRestimulation Tissue MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL]
26 11 S peptide SP 386,5 2,98 2,98 12 <=0 0 24 <=0 8650 19 0,32 0 610 11,88 11,88
27 12 S peptide SP 75 0,51 0 13 <=0 0 39 0,50 0 16 0,26 0 955 19,01 19,01
28 13 S peptide SP 178 1,19 1,19 10 <=0 0 30 0,14 0 15 0,24 0 246,5 4,69 4,69
29 14 S peptide SP 35 0,29 0 11 <=0 0 19 <=0 16 0,26 0 190,5 3,60 3,60
30 15 S peptide SP 203 1,38 1,38 9,5 <=0 0 25 <=0 15 0,24 0 365 7,01 7,01
31 16 S peptide SP 94 0,62 0 11 <=0 0 20,5 <=0 13 0,20 0 321 6,14 6,14
32 17 S peptide SP 586,5 5,09 5,09 12 <=0 0 21 <=0 11 0,16 0 885 17,54 17,54
33 18 S peptide SP 318 2,34 2,34 14 <=0 0 23 <=0 13 0,20 0 1203,5 24,38 24,38
34 21 S peptide SP 4966,5 149,75 149,75 35 <=0 0 266 10,75 10,75 27 0,49 0 2348 52,26 52,26
35 22 S peptide SP 5474 186,09 186,09 32 <=0 0 224,5 8,78 8,78 24 0,42 0 1414 29,10 29,10
36 23 S peptide SP 4423,5 117,49 117,49 30 <=0 0 336 14,14 14,14 30 0,56 0 1907 40,84 40,84
37 24 S peptide SP 2160 33,00 33,00 21 <=0 0 107 3,40 3,40 17 0,28 0 1130,5 22,78 22,78
38 25 S peptide SP 7059 356,73 356,73 47,5 <=0 0 682,5 31,94 31,94 32 0,60 0 2363,5 52,68 52,68
39 26 S peptide SP 8699,5 707,98 707,98 62 <=0 01080,5 54,24 54,24 31 0,58 0 3508 87,45 87,45
40 27 S peptide SP 2327 37,18 37,18 21 <=0 0 134,5 4,62 4,62 19 0,32 0 2460 55,32 55,32
41 28 S peptide SP 3945 93,72 93,72 29 <=0 0 178 6,61 6,61 22 0,38 0 2176 47,70 47,70
42 31 S peptide SP 12251 5435,41 4800 113 0,53 0 1666 90,58 90,58 53 1,09 1,09 2323 51,59 51,59
43 32 S peptide SP 11207 2540,72 2540,72 67 <=0 0 446,5 19,64 19,64 32 0,60 0 1969,5 42,40 42,40
44 33 S peptide SP 13878 55904,59 4800 123 0,67 02112,5 121,31 121,31 50 1,02 1,02 2650 60,65 60,65
45 34 S peptide SP 8838 752,35 752,35 79,5 0,05 0 1314 68,22 68,22 34,5 0,66 0 2477 55,79 55,79
46 35 S peptide SP 10020 1309,58 1309,58 77,5 0,02 0 1206 61,67 61,67 35 0,67 0 1807 38,38 38,38
47 36 S peptide SP 7982 521,41 521,41 55 <=0 0 882 42,87 42,87 27 0,49 0 1849,5 39,42 39,42
48 37 S peptide SP 9172,5 873,94 873,94 58,5 <=0 0 648 30,09 30,09 28 0,51 0 1861 39,70 39,70
49 38 S peptide SP 8488 646,01 646,01 59 <=0 0 1148 58,21 58,21 29 0,53 0 2611 59,54 59,54
52 16 PMA Iono SP 3238 65,07 65,07 338 3,83 3,83 10885 3220,14 3220,14 82 1,81 1,81 16603 5,85E+07 5250
51 17 PMA Iono SP 3585 78,26 78,26 349,5 4,01 4,01 11523 4700,47 4700,47 95 2,15 2,15 17179,5 5,85E+07 5250
50 18 PMA Iono SP 3246 65,35 65,35 319 3,55 3,55 10442 2593,95 2593,95 67 1,43 1,43 16984 5,85E+07 5250
60 25 PMA Iono SP 4643 129,80 129,80 324 3,62 3,62 10730 2975,64 2975,64 118 2,75 2,75 15930 9,10E+04 5250
59 26 PMA Iono SP 4585 126,45 126,45 371,5 4,35 4,35 13072 93260,89 8650 115,5 2,69 2,69 17962 5,85E+07 5250
58 27 PMA Iono SP 5308 173,46 173,46 306,5 3,36 3,36 10521,5 2691,16 2691,16 84,5 1,87 1,87 18176,5 5,85E+07 5250
66 31 PMA Iono SP 4589,5 126,71 126,71 304,5 3,33 3,33 11181 3790,84 3790,84 86 1,91 1,91 16344 1,67E+06 5250
67 34 PMA Iono SP 3133 61,38 61,38 348,5 3,99 3,99 12338 9811,27 8650 105 2,41 2,41 16468,5 5,85E+07 5250
68 37 PMA Iono SP 4499 121,62 121,62 334 3,77 3,77 11511 4662,32 4662,32 100,5 2,29 2,29 17556 5,85E+07 5250
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709107
  
 
R&D Report R -20-0112  Version 01  Page 79 of 105 
  Strictly Confidential  
Table 24: Cytokine raw data and calculated data for mCorVAC#15 , part 4 of 6  (SP) 
Acquired MFI values (MFI) were converted into concentrations by ProcartaPlex Analysis software ( ccalc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ, red) are  set to the ULOQ.  Commas are used as decimal 
sepa rators. Thousand were not separated by commas. Gr, group. M, mouse ID. PMAIono, PMA and Ionomycin (positive control). SP, spleen .  
 
  
Sample 
IDGrMRestimulation Tissue MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL]
26 11 S pep ide SP 88 0,16 0 9 <=0 0 32 4,18 0 33 0,81 0 11 0,39 0 41 48,45 0
27 12 S pep ide SP 252 2,99 0 10 <=0 0 85 14,17 14,17 36 0,90 0 10 0,35 0 18 <=0 0
28 13 S pep ide SP 22 <=0 0 8,5 <=0 0 28 3,51 0 23 0,52 0 9 0,31 0 27 20,34 0
29 14 S pep ide SP 16,5 <=0 0 10 <=0 0 17,5 1,81 0 21 0,46 0 6,5 0,22 0 15 <=0 0
30 15 S pep ide SP 45,5 <=0 0 9 <=0 0 33 4 36 0 29 0,69 0 9 0,31 0 29 24,53 0
31 16 S pep ide SP 23,5 <=0 0 9 <=0 0 17,5 1,81 0 20 0,43 0 8 0,27 0 19 2,11 0
32 17 S pep ide SP 81 0,07 0 9 <=0 0 38 5,23 5,23 34 0,84 0 12 0,42 0 50 65,59 65,59
33 18 S pep ide SP 78 0,04 0 10 <=0 0 32 4,18 0 41 1,05 0 12 0,42 0 33 32,69 0
34 21 S pep ide SP 302 3,98 0 15 <=0 0 243 49,41 49,41 151 4,63 4,63 90 3,06 3,06 436,5 706,91 706,91
35 22 S pep ide SP 308,5 4,12 0 33 0,59 0 172 32,85 32,85 87 2,50 0 89,5 3,05 3,05 508 822,51 822,51
36 23 S pep ide SP 452 7,19 7,19 17 <=0 0 222 44,41 44,41 107 3,15 3,15 75 2,57 2,57 375,5 608,48 608,48
37 24 S pep ide SP 267,5 3,30 0 10,5 <=0 0 112 19,73 19,73 56 1,51 0 26 0,92 0 170 273,80 273,8
38 25 S pep ide SP 446,5 7,06 7,06 26 0,31 0 303 64,13 64,13 165 5,12 5,12 152,5 5,08 5,08 674,5 1094,22 1094,22
39 26 S pep ide SP 723 13,65 13,65 44 1,05 0 397 88 29 88,29 182 5,71 5,71 264 8,61 8,61 911,5 1491,08 1491,08
40 27 S pep ide SP 290,5 3,75 0 17 <=0 0 176 33,75 33,75 77 2,17 0 59 2,04 0198,5 320,97 320,97
41 28 S pep ide SP 269 3,33 0 13 <=0 0178,5 34,32 34,32 144 4,40 4,40 87 2,96 2,96 350 567,33 567,33
42 31 S pep ide SP 553 9,50 9,50 34 0,63 01090,5 298,53 298,53 836 32,17 32,17 850 27,38 27,38 1542 2640,12 2640,12
43 32 S pep ide SP 297,5 3,89 0 22 0,16 0 184 35,57 35,57 230 7,41 7,41 497,5 15,98 15,98 1248 2084,32 2084,32
44 33 S pep ide SP 1721 43,68 43,68 33 0,59 0 869 225,90 225,90 383 13,13 13,13 1383 45,75 45,75 1735,5 3029,31 3029,31
45 34 S pep ide SP 1594,5 39,34 39,34 55 1,52 0 845 218,32 218,32 217,5 6,97 6,97 461,5 14,84 14,84 936 1532,98 1532,98
46 35 S pep ide SP 921 18,85 18,85 17 <=0 0552,5 130,83 130,83 224 7,20 7,20 613 19,67 19,67 1182 1964,71 1964,71
47 36 S pep ide SP 429,5 6,69 6,69 17 <=0 0285,5 59,77 59,77 182 5,71 5,71 419 13,50 13,50 864 1410,36 1410,36
48 37 S pep ide SP 382,5 5,66 5,66 17 <=0 0207,5 41,01 41,01 183,5 5,76 5,76 615,5 19,75 19,75 1009 1658,93 1658,93
49 38 S pep ide SP 605 10,74 10,74 20 0,08 0 375 82 52 82,52 205,5 6,54 6,54 483 15,52 15,52 831 1354,65 1354,65
52 16 PMA Iono SP 5638 283,37 283,37 4671,5 414,22 414,22 1682 515,81 515,81 4643 470,16 470,16 6211 441,29 441,29 1531,5 2619,57 2619,57
51 17 PMA Iono SP 4136 161,80 161,80 5052 470,40 470,40 1556 466,69 466,69 4764 518,54 518,54 6473 501,59 501,59 1571,5 2698,16 2698,16
50 18 PMA Iono SP 4102 159,57 159,57 7938,5 1092,17 1092,17 1234 5 348 31 348,31 4334,5 378,81 378,81 5295 296,02 296,02 1397,5 2362,01 2362,01
60 25 PMA Iono SP 1610 39,87 39,87 6150,5 661,29 661,29 2882 1065,19 1065,19 4961 626,92 626,92 4831 245,44 245,44 1761 3082,15 3082,15
59 26 PMA Iono SP 3768,5 138,70 138,70 7970 1101,46 1101,46 4470 2065,48 2065,48 5630,5 1732,84 731,2 5489 320,78 320,78 1775 3111,32 3111,32
58 27 PMA Iono SP 1620,5 40,22 40,22 3044,5 219,53 219,53 2258 760,46 760,46 5527 1732,84 731,2 4976,5 260,16 260,16 1813 3191,10 3191,1
66 31 PMA Iono SP 1616,5 40,09 40,09 5670 572,11 572,11 1719 530,52 530,52 4811,5 540,57 540,57 5771,5 361,79 361,79 1645 2844,76 2844,76
67 34 PMA Iono SP 2902,5 92,23 92,23 4899 447,25 447,25 3504,5 1415,19 1415,19 5162 832,46 731,2 6452 496,30 496,30 1568 2691,25 2691,25
68 37 PMA Iono SP 1295 29,70 29,70 4521 393,25 393,25 2322 789,75 789,75 5321 1977,29 731,2 6617 540,43 540,43 1864 3299,55 3299,55
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709108
  
 
R&D Report R -20-0112  Version 01  Page 80 of 105 
  Strictly Confidential  
Table 25: Cytokine raw data and calculated data for mCorVAC#15 , part 5 of 6  (SP) 
Acquired MFI val ues (MFI) were converted into concentrations by ProcartaPlex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ, red) are set to the ULOQ  LN, lymph node. Commas are used 
as decimal separators. Thousand were not separated by commas. Gr, group. M, mouse ID. PMAIono, PMA and Ionomycin (positive control).  
 
  
Sample 
IDGrMRestimulation Tissue MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL]
53 21 Medium LN 39,5 0,31 0 10 <=0 0 22 <=0 6 <=0 0 269 5,13 5,13
54 22 Medium LN 44 0,33 0 10 <=0 0 22 <=0 7 0,08 0 432,5 8,34 8,34
55 23 Medium LN 28 0,25 0 9 <=0 0 14 <=0 6 <=0 0 234,5 4,45 4,45
56 31 Medium LN 62,5 0,43 0 9 <=0 0 16 <=0 6 <=0 0 355 6,81 6,81
57 33 Medium LN 235 1,63 1,63 9 <=0 0 20 <=0 7 0,08 0 166 3,12 3,12
61 34 Medium LN 68 0,47 0 9 <=0 0 14 <=0 8 0,1 0 204 3,86 3,86
62 35 Medium LN 457 3,68 3,68 12 <=0 0 18 <=0 7 0,08 0 786 15,48 15,48
63 37 Medium LN 57 0,40 0 9 <=0 0 17 <=0 7 0,08 0 157,5 2,95 2,95
64 38 Medium LN 99 0,65 0 8,5 <=0 0 19 <=0 6 <=0 0 782 15,39 15,39
69 21 S peptide LN 561,5 4,81 4,81 11 <=0 0 33 0,26 0 6 <=0 0 208,5 3,95 3,95
70 22 S peptide LN 1013 10,70 10,70 14 <=0 0 118 3,88 3,88 7 0,08 0 1873,5 40,01 40,01
71 23 S peptide LN 938,5 9,61 9,61 12 <=0 0 53 1,07 0 7 0,08 0 436 8,41 8,41
72 31 S peptide LN 678 6,17 6,17 12 <=0 0 31 0,18 0 8 0,1 0 703 13,77 13,77
73 33 S peptide LN 916 9,30 9,30 11,5 <=0 0 40 0,54 0 7 0,08 0 331 6,34 6,34
77 34 S peptide LN 1924 27,51 27,51 14 <=0 0 43 0,66 0 7 0,08 0 723,5 14,19 14,19
78 35 S peptide LN 1095 11,94 11,94 13,5 <=0 0 34,5 0,32 0 7 0,08 0 367 7,04 7,04
79 37 S peptide LN 1686 22,46 22,46 13 <=0 0 51 0,98 0 6 <=0 0 701 13,73 13,73
80 38 S peptide LN 564 4,83 4,83 10 <=0 0 19,5 <=0 0 6 <=0 0 658,5 12,86 12,86
74 21 PMA Iono LN 4496,5 121,48 121,48 294 3,17 3,17 6532 662,77 662,77 59 1,24 1,24 17418 5,85E+07 5250
75 23 PMA Iono LN 4808,5 139,72 139,72 406 4,88 4,88 8767 1352,13 1352,13 66 1,41 1,41 19327 5,85E+07 5250
76 27 PMA Iono LN 3138,5 61,57 61,57 258 2,63 2,63 8778 1357,23 1357,23 51 1,04 1,04 16182 3,09E+05 5250
81 33 PMA Iono LN 2999 56,86 56,86 232 2,25 2,25 6309,5 618,58 618,58 51 1,04 1,04 16058,5 1,54E+05 5250
65 34 PMA Iono LN 3287 66,84 66,84 248 2,49 2,49 8188,5 1114,99 1114,99 57 1,19 1,19 17501 5,85E+07 5250
1 37 PMA Iono LN 3505 75,08 75,08 281 2,98 2,98 7593,5 921,89 921,89 66,5 1,42 1,42 16859,50 5,85E+07 5250IFN-gamma IL-12p70 IL-13 IL-1beta IL-2
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709109
  
 
R&D Report R -20-0112  Version 01  Page 81 of 105 
  Strictly Confidential  
Table 26: Cytokine raw data and calculated data for mCorVAC#15 , part 6 of 6  (LN) 
Acquired MFI values (MFI) were converted into concentrations by ProcartaPlex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit  of quantification (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ, red) are  set to the ULOQ. Commas are used as decimal 
separators. Thousand were not separated by commas. LN, lymph node. Gr, group. M, mouse ID. PMAIon o, PMA and Ionomycin (positive control).  
 
  
Sample 
IDGrMRestimulation Tissue MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL]
53 21 Medium LN 9 <=0 0 25 0,27 0 12 0,99 0 28 0,66 0 9 0,31 0 15 <=0 0
54 22 Medium LN 7 <=0 0 32,5 0,57 0 15 1,43 0 21 0,46 0 7 0,24 0 14 <=0 0
55 23 Medium LN 6,5 <=0 0 19 0,05 0 11 0,85 0 21 0,46 0 7 0,24 0 13 <=0 0
56 31 Medium LN 7 <=0 0 10 <=0 0 12 0,99 0 22 0,49 0 7 0,24 0 15 <=0 0
57 33 Medium LN 10 <=0 0 20 0,08 0 13 1,13 0 29 0,69 0 10 0,35 0 26 18,22 0
61 34 Medium LN 9 <=0 0 13 <=0 0 14 1,28 0 33 0,81 0 6 <=0 0 14 <=0 0
62 35 Medium LN 15 <=0 0 10 <=0 0 12 0,99 0 26 0,60 0 8 0,27 0 41,5 49,42 0
63 37 Medium LN 13 <=0 0 14 <=0 0 15 1,43 0 29 0,69 0 6 <=0 0 14,5 <=0 0
64 38 Medium LN 12 <=0 0 15 <=0 0 15 1,43 0 26 0,60 0 7 0,24 0 17 <=0 0
69 21 S pep ide LN 12,5 <=0 0 30 0,47 0 13 1,13 0 34 0,84 0 11 0,39 0 52,5 70,27 70,27
70 22 S pep ide LN 46,5 <=0 0 215 9,08 9,08 23 2,68 0 46,5 1,22 0 47 1,64 0 83,5 126,35 126,35
71 23 S pep ide LN 11 <=0 0 96,5 3,38 3,38 15 1,43 0 33 0,81 0 20 0,71 0 82 123,69 123,69
72 31 S pep ide LN 32 <=0 0 20 0,08 0 14 1,28 0 31 0,75 0 17 0,60 0 66,5 95,97 95,97
73 33 S pep ide LN 25 <=0 0 16 <=0 0 13 1,13 0 30,5 0,74 0 17,5 0,62 0 76 113,04 113,04
77 34 S pep ide LN 44,5 <=0 0 15 <=0 0 21 2 36 0 54 1,45 0 31 1,09 0 156 250,44 250,44
78 35 S pep ide LN 54 <=0 0 18 0,01 0 15 1,43 0 40 1,02 0 21 0,75 0 91 139,53 139,53
79 37 S pep ide LN 49,5 <=0 0 27,5 0,37 0 18,5 1,96 0 45 1,17 0 26 0,92 0136,5 217,66 217,66
80 38 S pep ide LN 20 <=0 0 14 <=0 0 15 1,43 0 26 0,60 0 11 0,39 0 52 69,33 69,33
74 21 PMA Iono LN 1662 41,64 41,64 8746 1353,47 1353,47 359,5 78,50 78,50 5696 1732,84 731,2 3332,5 133,64 133,64 1848 3265,35 3265,35
75 23 PMA Iono LN 1720 43,64 43,64 11982 3124,01 3124,01 383 84,61 84,61 6322,5 1732,84 731,2 3394 137,20 137,20 1879,5 3332,84 3332,84
76 27 PMA Iono LN 1056,5 22,63 22,63 10201 1974,51 1974,51 569 135,52 135,52 5226 962,86 731,2 1981 68,61 68,61 1547 2649,93 2649,93
81 33 PMA Iono LN 737 14,00 14,00 7712 1027,35 1027,35 257,5 52,91 52,91 4908 592,68 592,68 3682 154,80 154,80 1503 2564,06 2564,06
65 34 PMA Iono LN 853 17,02 17,02 7043,5 854,66 854,66 435 98,41 98,41 5309 1469,86 731,2 5271,5 293,18 293,18 1475,5 2510,88 2510,88
1 37 PMA Iono LN 943,5 19,47 19,47 7862 1069,89 1069,89 491 113,65 113,65 5508,5 1732,84 731,2 4949 257,31 257,31 1666 2887,17 2887,17IL-4 IL-5 IL-6 TNF-alpha GM-CSF IL-18
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709110
  
 
R&D Report R -20-0112  Version 01  Page 82 of 105 
  Strictly Confidential  
Table 27: Cytokine raw data and calculated data for mCorVAC#16 , part 1 of 6 (SP) 
Acquired MFI values (MFI) were converted into concentrations by ProcartaPlex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ, red) are  set to the ULOQ . Commas are used as decimal 
separators. T housand were not separated by commas. Gr, group. M, mouse ID. SP, spleen .  
 
  
PlateSample 
IDGrMRestimulation Tissue MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mLcfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL MFIccalc 
[pg/mL]cfin 
[pg/mL]
1 1 11 Medium SP 98,5 2,06 2,06 13 <=0 0 35 2,39 2,39 23 1,64 1,64 971,5 59,72 59,72
1 2 12 Medium SP 20 0,17 0 10 <=0 0 24 0,70 0 17 0,94 0 106 9,49 9,49
1 3 13 Medium SP 76,5 1,50 1,50 13 <=0 0 41 3,25 3,25 16 0,82 0 646,5 42,56 42,56
1 4 14 Medium SP 78 1,54 1,54 11 <=0 0 29 1,49 0 22 1,53 1,53 692,5 45,05 45,05
1 5 15 Medium SP 26 0,30 0 9 <=0 0 23 0,53 0 18 1,06 1,06 404,5 28,98 28,98
1 6 16 Medium SP 236 5,80 5,80 13 <=0 0 42 3,40 3,40 18 1,06 1,06 354 25,99 25,99
1 7 17 Medium SP 259,5 6,47 6,47 13 <=0 0 28 1,34 018,5 1,12 1,12 426 30,24 30,24
1 8 18 Medium SP 53 0,92 0 15 <=0 0 23 0,53 0 20 1,30 1,30 776 49,50 49,50
1 9 21 Medium SP 44 0,71 0 10 <=0 0 24 0,70 0 15 0,69 0 245 19,22 19,22
1 10 22 Medium SP 275 6,91 6,91 17 <=0 0 59 5,72 5,72 16 0,82 0 955 58,87 58,87
1 11 23 Medium SP 161 3,71 3,71 26,5 0,5 0 95 10,38 10,38 19 1,18 1,18 848 53,29 53,29
1 12 24 Medium SP 228 5,57 5,57 17 <=0 0 52 4,78 4,78 16 0,82 0 773 49,34 49,34
1 13 25 Medium SP 1728 57,82 57,82 27 0,53 0 93 10,12 10,12 18 1,06 1,06 1119,5 67,33 67,33
1 14 26 Medium SP 54 0,95 0 12 <=0 0 22 0,35 0 17 0,94 0 226,5 18,02 18,02
1 15 27 Medium SP 128,5 2,84 2,84 13 <=0 0 47 4,09 4,09 15 0,69 0 953,5 58,79 58,79
1 16 28 Medium SP 2259,5 80,30 80,30 27,5 0,55 0 68 6,91 6,91 20 1,30 1,30 1375,5 80,35 80,35
1 17 31 Medium SP 79 1,56 1,56 10 <=0 0 27 1,18 0 18 1,06 1,06 132 11,47 11,47
1 18 32 Medium SP 79 1,56 1,56 12 <=0 0 29 1,49 0 19 1,18 1,18 296 22,45 22,45
1 19 33 Medium SP 84,5 1,70 1,70 11 <=0 0 25 0,86 0 23 1,64 1,64 142,5 12,24 12,24
1 20 34 Medium SP 919,5 27,52 27,52 22 0,27 0 80 8,47 8,47 22 1,53 1,53 956,5 58,95 58,95
1 21 35 Medium SP 322,5 8,30 8,30 16 <=0 0 60 5,86 5,86 33 2,72 2,72 869 54,39 54,39
1 22 36 Medium SP 130 2,88 2,88 12,5 <=0 0 44 3,68 3,68 19,5 1,24 1,24 374 27,18 27,18
1 23 37 Medium SP 108,5 2,32 2,32 12 <=0 0 32,5 2,02 0 22 1,53 1,53 189,5 15,54 15,54
1 24 38 Medium SP 168 3,90 3,90 13 <=0 0 39,5 3,04 3,04 17 0,94 0 1218 72,35 72,35IL-12p70 IL-13 IL-1beta IL-2 IFN-gamma
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709111
  
 
R&D Report R -20-0112  Version 01  Page 83 of 105 
  Strictly Confidential  
Table 28: Cytokine raw data and calculated data for mCorVAC#16 , part 2 of 6 (SP) 
Acquired MFI values (MFI) were converted into concentrations by Procarta Plex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ, red) are  set to the ULOQ. Commas are used as decimal 
separators. Thousand were not separated by commas. Gr, group. M, mouse ID. SP, spleen.  
 
  
Sample 
IDGrMRestimulation Tissue MFIccalc 
[pg/mL]cfin 
[pg/mL MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mLcfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL]
1 11 Medium SP 106,5 5,5 5,5 10 <=0 0 48 26,82 26,82 49 5,51 5,51 7 <=0 0 21 <=0 0
2 12 Medium SP 21,5 0,8 0 11 <=0 0 18 5,99 5,99 26 2,49 0 5 <=0 0 13 <=0 0
3 13 Medium SP 91 4,7 4,7 12 <=0 0 43,5 23,94 23,94 34 3,61 3,61 8 <=0 0 17 <=0 0
4 14 Medium SP 83 4,2 4,2 11 <=0 0 43 23,61 23,61 44 4,90 4,90 8 <=0 0 17 <=0 0
5 15 Medium SP 23 0,9 0 11 <=0 0 29 14,20 14,20 26,5 2,57 0 5,5 <=0 0 14 <=0 0
6 16 Medium SP 429 22,0 22,0 19 0,2 0129,5 73,96 73,96 41 4,52 4,52 7 <=0 0 29 114,63 0
7 17 Medium SP 63 3,2 3,2 10 <=0 0 30 14,90 14,90 38 4,14 4,14 8 <=0 0 32 144,62 0
8 18 Medium SP 50 2,4 2,4 9 <=0 0 185 103,35 103,35 652,5 56,48 56,48 7 <=0 0 16,5 <=0 0
9 21 Medium SP 86,5 4,4 4,4 12 <=0 0 34 17,65 17,65 32 3,34 3,34 7 <=0 0 13 <=0 0
10 22 Medium SP 487,5 24,9 24,9 12 <=0 0 122 69,87 69,87 77 8,68 8,68 19 4,13 0 38,5 202,86 202,86
11 23 Medium SP 1087,5 55,5 55,5 12 <=0 0 297 159,65 159,65 69 7,81 7,81 14 2,36 0 29 114,63 0
12 24 Medium SP 458 23,4 23,4 28 2,39 0 128 73,14 73,14 57 6,45 6,45 8 <=0 0 27 92,89 0
13 25 Medium SP 1096 55,9 55,9 15 <=0 0292,5 157,45 157,45 67 7,59 7,59 19,5 4,29 0 162 929,78 929,78
14 26 Medium SP 206,5 10,7 10,7 14 <=0 0 60,5 34,59 34,59 34 3,61 3,61 6 <=0 0 14 <=0 0
15 27 Medium SP 294,5 15,2 15,2 9 <=0 0 105 60,46 60,46 51,5 5,81 5,81 11 0,87 0 21,5 14,31 0
16 28 Medium SP 395 20,3 20,3 12 <=0 0 163 91,86 91,86 529 47,07 47,07 17 3,48 0 198 1098,85 1098,85
17 31 Medium SP 69,5 3,5 3,5 10 <=0 0 33 16,97 16,97 32 3,34 3,34 7 <=0 0 16 <=0 0
18 32 Medium SP 114 5,9 5,9 13 <=0 0 39 21,00 21,00 37 4,01 4,01 7 <=0 0 17 <=0 0
19 33 Medium SP 63 3,2 3,2 12 <=0 0 34,5 17,99 17,99 37 4,01 4,01 8 <=0 0 18 <=0 0
20 34 Medium SP 608,5 31,0 31,0 12 <=0 0 174 97,63 97,63 64 7,25 7,25 18 3,81 0 78 479,51 479,51
21 35 Medium SP 345 17,7 17,7 14 <=0 0 122 69,87 69,87 51 5,75 5,75 10 <=0 0 34 163,35 0
22 36 Medium SP 219 11,3 11,3 9 <=0 0 92 53,11 53,11 36 3,88 3,88 8 <=0 0 21 <=0 0
23 37 Medium SP 211,5 11,0 11,0 17 <=0 0 69,5 40,01 40,01 41 4,52 4,52 9 <=0 0 20 <=0 0
24 38 Medium SP 144 7,5 7,5 14 <=0 0 47 26,18 26,18 41 4,52 4,52 8 <=0 0 23,5 48,81 0IL-4 IL-5 IL-6 TNF-alpha GM-CSF IL-18
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709112
  
 
R&D Report R -20-0112  Version 01  Page 84 of 105 
  Strictly Confidential  
Table 29: Cytokine raw data and calculated data for mCorVAC#16 , part 3 of 6 (SP) 
Acquired MFI values (MFI) were converte d into concentrations by ProcartaPlex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ, red) are set to the ULOQ. Gr, group. M, mouse ID. PMAIono, 
PMA and Ionomycin (positive control). SP, spleen.  
  
PlateSample 
IDGrMRestimulation Tissue MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mLcfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL MFIccalc 
[pg/mL]cfin 
[pg/mL]
1 25 11 S peptide SP 60,5 1,10 1,10 10 <=0 0 24 0,70 0 19 1,18 1,18 346 25,51 25,51
1 26 12 S peptide SP 70 1,34 1,34 10 <=0 0 24 0,70 0 16 0,82 0 101 9,10 9,10
1 27 13 S peptide SP 53 0,92 0 9,5 <=0 0 21 0,17 0 14 0,56 0 122,5 10,76 10,76
1 28 14 S peptide SP 182,5 4,30 4,30 12 <=0 0 27 1,18 020,5 1,36 1,36 348 25,63 25,63
1 29 15 S peptide SP 46 0,75 0 14 <=0 0 31 1,80 015,5 0,76 0 151 12,85 12,85
1 30 16 S peptide SP 781,5 22,82 22,82 17,5 0,03 0 66,5 6,72 6,72 19 1,18 1,18 697 45,29 45,29
1 31 17 S peptide SP 276 6,94 6,94 12 <=0 0 23 0,53 0 18 1,06 1,06 331 24,60 24,60
1 32 18 S peptide SP 248,5 6,15 6,15 14 <=0 0 29 1,49 0 25 1,87 1,87 351 25,81 25,81
1 33 21 S peptide SP 13171 5808,01 4800 174 7,19 7,19 3368 382,28 382,28 48 4,21 4,21 1871 105,49 105,49
1 34 22 S peptide SP 14077 5808,01 4800 184,5 7,65 7,65 5418 676,64 676,64 65 5,80 5,80 3257 179,56 179,56
1 35 23 S peptide SP 15533 5808,01 4800 210 8,78 8,78 4642 555,60 555,60 97 8,64 8,64 1595 91,47 91,47
1 36 24 S peptide SP 13978 5808,01 4800 180 7,45 7,45 4989,5 608,07 608,07 58 5,16 5,16 2848 156,78 156,78
1 37 25 S peptide SP 13461 5808,01 4800 164 6,75 6,75 3984,5 462,82 462,82 52 4,59 4,59 2266,5 125,84 125,84
1 38 26 S peptide SP 13336,5 5808,01 4800 169 6,97 6,97 4404 521,10 521,10 61 5,44 5,44 2555 141,01 141,01
1 39 27 S peptide SP 12383 5808,01 4800 170 7,01 7,01 5234 646,64 646,64 52 4,59 4,59 2893,5 159,27 159,27
1 40 28 S peptide SP 17133 5808,01 4800 236 9,93 9,93 4725 567,90 567,90 89,5 7,99 7,99 1762 99,94 99,94
1 41 31 S peptide SP 13734 5808,01 4800 121,5 4,86 4,86 505 57,29 57,29 58 5,16 5,16 1366 79,87 79,87
1 42 32 S peptide SP 13464 5808,01 4800 119 4,75 4,75 653 73,40 73,40 54 4,78 4,78 1191 70,98 70,98
1 43 33 S peptide SP 13090,5 5808,01 4800 112 4,44 4,44 610 68,74 68,74 59 5,25 5,25 954 58,82 58,82
1 44 34 S peptide SP 15944 5808,01 4800 159 6,53 6,53 1533 168,50 168,50 76 6,80 6,80 2185 121,61 121,61
1 45 35 S peptide SP 14532,5 5808,01 4800 152 6,22 6,22 2293,5 253,39 253,39 87 7,77 7,77 1549 89,14 89,14
1 46 36 S peptide SP 15439 5808,01 4800 151 6,17 6,17 891 99,08 99,08 61 5,44 5,44 2981 164,08 164,08
1 47 37 S peptide SP 13213,5 5808,01 4800 124 4,98 4,98 1358 149,45 149,45 58 5,16 5,16 1839,5 103,88 103,88
1 48 38 S peptide SP 13278 5808,01 4800 104 4,08 4,08 414 47,28 47,28 53 4,69 4,69 1581 90,76 90,76
1 49 11 PMA Iono SP 4486 201,33 201,33 350 15,01 15,01 9735 1951,80 1951,80 97 8,64 8,64 16018 5,7E+04 1312,5
1 50 12 PMA Iono SP 4369,5 193,67 193,67 399,5 17,25 17,25 11225 4223,94 2162,5 108 9,58 9,58 15895 5,7E+04 1312,5
1 51 13 PMA Iono SP 4254 186,26 186,26 389 16,77 16,77 10268 2346,54 2162,5 104 9,24 9,24 15356 5,7E+04 1312,5
1 52 21 PMA Iono SP 4815 223,94 223,94 348 14,92 14,92 11244 4327,85 2162,5 134,5 11,80 11,80 16167 5,7E+04 1312,5
1 53 22 PMA Iono SP 6032 323,14 323,14 271 11,48 11,48 11185 4031,79 2162,5 99 8,81 8,81 15750,5 5,7E+04 1312,5
1 54 23 PMA Iono SP 5693 292,66 292,66 281,5 11,94 11,94 10321 2395,89 2162,5 111 9,84 9,84 13797 5,7E+04 1312,5
1 55 31 PMA Iono SP 4782,5 221,64 221,64 403,5 17,43 17,43 11140 3848,56 2162,5 120 10,60 10,60 16203,5 5,7E+04 1312,5
1 56 32 PMA Iono SP 5422 270,00 270,00 323 13,80 13,8 10867 3124,27 2162,5 103 9,16 9,16 15723 5,7E+04 1312,5
1 57 33 PMA Iono SP 5531 278,95 278,95 261,5 11,06 11,06 9846 2022,03 2022,03 98 8,73 8,73 14422 5,7E+04 1312,5IFN-gamma IL-12p70 IL-13 IL-1beta IL-2
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709113
  
 
R&D Report R -20-0112  Version 01  Page 85 of 105 
  Strictly Confidential  
Table 30: Cytokine raw data and calculated data for mCorVAC#16 , part 4 of 6 (SP) 
Acquired MFI values (MFI) were convert ed into concentrations by ProcartaPlex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ,  red) are  set to the ULOQ. Commas are used as decimal 
separators. Thousand were not separated by commas. Gr, group. M, mouse ID. PMAIono, PMA and Ionomycin (positive control). SP, spleen .  
 
Sample 
IDGrMRestimulation Tissue MFIccalc 
[pg/mL]cfin 
[pg/mL MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mLcfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL]
25 11 S pep ide SP 47 2,3 2,3 9 <=0 0 41 22,31 22,31 52 5,87 5,87 7 <=0 0 15 <=0 0
26 12 S pep ide SP 68 3,4 3,4 11,5 <=0 0 32 16,29 16,29 32 3,34 3,34 8 <=0 0 16 <=0 0
27 13 S pep ide SP 58 2,9 2,9 10 <=0 0 37 19,67 19,67 28,5 2,86 2,86 6 <=0 0 14 <=0 0
28 14 S pep ide SP 121 6,3 6,3 9 <=0 0 65,5 37,61 37,61 44 4,90 4,90 8 <=0 0 25 69,01 0
29 15 S pep ide SP 320 16,5 16,5 9 <=0 0 89,5 51,68 51,68 33 3,48 3,48 7 <=0 0 16 <=0 0
30 16 S pep ide SP 545 27,8 27,8 14 <=0 0 183 102,32 102,32 53 5,99 5,99 15 2,76 0 71 435,82 435,82
31 17 S pep ide SP 167 8,7 8,7 10 <=0 0 50 28,08 28,08 38 4,14 4,14 7 <=0 0 30 124,92 0
32 18 S pep ide SP 171 8,9 8,9 9,5 <=0 0 69 39,71 39,71 245,5 24,38 24,38 10 <=0 0 35 172,42 0
33 21 S pep ide SP 3097 175,0 175,0 80,5 11,50 11,5 1939 921,39 921,39 748,5 63,72 63,72 1357 133,31 133,31 1730 6283,48 6283,48
34 22 S pep ide SP 2500 135,8 135,8 178,5 25,53 25,53 1790 850,48 850,48 719 61,50 61,50 1401 136,55 136,55 2007,5 7154,03 7154,03
35 23 S pep ide SP 2530 137,7 137,7 120,5 17,47 17,47 2662 1280,76 1280,76 882 73,74 73,74 2013 180,57 180,57 2382 8351,97 8351,97
36 24 S pep ide SP 2212,5 118,2 118,2 321 43,79 43,79 1915,5 910,15 910,15 694 59,61 59,61 1559 148,08 148,08 1846,5 6647,80 6647,80
37 25 S pep ide SP 2365,5 127,5 127,5 271 37,56 37,56 2038 969,03 969,03 601,5 52,61 52,61 840 93,57 93,57 1806 6521,00 6521,00
38 26 S pep ide SP 1640 85,2 85,2 146,5 21,15 21,15 1583,5 753,58 753,58 830 69,84 69,84 1562,5 148,33 148,33 1889,5 6782,64 6782,64
39 27 S pep ide SP 2880 160,3 160,3 200 28,40 28,4 2046 972,90 972,90 827 69,61 69,61 1447 139,92 139,92 1678,5 6122,76 6122,76
40 28 S pep ide SP 1653 85,9 85,9 87,5 12,58 12,58 2760,5 1332,05 1332,05 2128,5 173,56 173,56 2153,5 190,53 190,53 2511 8773,84 8773,84
41 31 S pep ide SP 919 46,8 46,8 24 1,52 0 620 312,22 312,22 657 56,82 56,82 460 60,65 60,65 1982 7073,58 7073,58
42 32 S pep ide SP 839,5 42,7 42,7 29 2,60 0488,5 251,16 251,16 680 58,56 58,56 509 65,21 65,21 1791 6474,08 6474,08
43 33 S pep ide SP 477 24,4 24,4 133 19,26 19,26 334 177,69 177,69 551,5 48,80 48,80 368 51,71 51,71 1829,5 6594,56 6594,56
44 34 S pep ide SP 787,5 40,0 40,0 40 4,74 0 786 388,32 388,32 1065 87,50 87,50 1142 117,21 117,21 2457,5 8598,20 8598,20
45 35 S pep ide SP 1429 73,6 73,6 71 10,01 10,01 1561 743,11 743,11 803 67,81 67,81 860 95,18 95,18 2058 7313,69 7313,69
46 36 S pep ide SP 668,5 34,0 34,0 60 8,22 8,22 624 314,07 314,07 1027 84,63 84,63 954 102,67 102,67 2260 7957,81 7957,81
47 37 S pep ide SP 825 42,0 42,0 78 11,11 11,11 494 253,73 253,73 587 51,51 51,51 656 78,24 78,24 1859,5 6688,55 6688,55
48 38 S pep ide SP 454 23,2 23,2 34 3,60 0 294 158,18 158,18 631,5 54,89 54,89 393 54,19 54,19 1951 6975,93 6975,93
49 11 PMA Iono SP 2056 108,9 108,9 6519,5 872,65 872,65 3366 1662,56 1662,56 5721 4142,40 731,2 5495 461,34 461,34 1671 6099,37 6099,37
50 12 PMA Iono SP 3480 202,3 202,3 9358,5 1609,56 1609,56 4770 2563,19 2563,19 5510,5 1256,15 731,2 5864 502,13 502,13 1411 5288,61 5288,61
51 13 PMA Iono SP 1521 78,6 78,6 7790,5 1147,31 1147,31 4659 2483,32 2483,32 5649,5 1891,68 731,2 5892,5 505,47 505,47 1638 5996,47 5996,47
52 21 PMA Iono SP 1759 91,8 91,8 4315,5 516,09 516,09 4106 2109,67 2109,67 5675 2216,16 731,2 6114 532,52 532,52 1684 6139,92 6139,92
53 22 PMA Iono SP 1338 68,7 68,7 5758 735,82 735,82 3354 1655,73 1655,73 5067 752,98 731,2 6086 528,98 528,98 1184 4576,36 4576,36
54 23 PMA Iono SP 1183 60,5 60,5 5530,5 698,08 698,08 3337 1646,08 1646,08 4612 557,74 557,74 5094 421,22 421,22 1063 4192,38 4192,38
55 31 PMA Iono SP 1795,5 93,9 93,9 10589 2139,77 2000 4271 2217,20 2217,20 6012 4142,40 731,2 5849 500,39 500,39 1660,5 6066,62 6066,62
56 32 PMA Iono SP 870 44,2 44,2 11204,5 2499,94 2000 3363,5 1661,14 1661,14 5047 741,29 731,2 5963 513,87 513,87 1215,5 4675,72 4675,72
57 33 PMA Iono SP 1056,5 53,9 53,9 8771 1415,41 1415,41 2883 1396,74 1396,74 4732 598,42 598,42 4594 375,76 375,76 1068 4208,33 4208,33IL-18 IL-4 IL-5 IL-6 TNF-alpha GM-CSF
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709114
  
 
R&D Report R -20-0112  Version 01  Page 86 of 105 
  Strictly Confidential  
Table 31: Cytokine raw data and calculate d data for mCorVAC#16 , part 5 of 6 (LN) 
Acquired MFI values (MFI) were converted into concentrations by ProcartaPlex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ, red) are  set to the ULOQ. Commas are used as decimal 
separators. Thousand were not separated by commas. LN, lymph node. Gr, group. M, mouse ID. PMAIono, PMA and Ionomycin (posit ive control).  
 
Plate Sample 
IDGrMRestimulat
ionTissue MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL]
2 1 12Medium LN 30 0,06 0 10 <=0 032,5 2,58 2,58 6 0,27 0 172 14,15 14,15
2 2 13Medium LN 35,5 0,23 0 9 <=0 0 32 2,52 2,52 6 0,27 0 520 33,53 33,53
2 3 15Medium LN 32 0,12 0 10 <=0 0 29 2,18 2,18 7 0,40 0 51 5,29 5,29
2 7 21Medium LN 93 1,76 1,76 9 <=0 0 31 2,41 2,41 6 0,27 0 190 15,30 15,30
2 8 22Medium LN 159 3,37 3,37 10 <=0 0 24 1,60 0 7 0,40 0275,5 20,43 20,43
2 9 23Medium LN 194 4,20 4,20 8 <=0 0 24 1,60 0 8 0,52 0 130 11,36 11,36
2 10 24Medium LN 427 9,61 9,61 11 <=0 0 33 2,63 2,63 7 0,40 0 247 18,76 18,76
2 11 25Medium LN 86 1,58 1,58 11 <=0 0 35 2,85 2,85 7 0,40 0 503 32,66 32,66
2 12 26Medium LN 106 2,08 2,08 10 <=0 063,5 5,86 5,86 7 0,40 0693,5 42,09 42,09
2 13 27Medium LN 452,5 10,20 10,20 11 <=0 0 85 8,01 8,01 8 0,52 0 373 25,86 25,86
2 14 28Medium LN 275 6,10 6,10 11 <=0 0 43 3,73 3,73 7 0,40 0 407 27,68 27,68
2 4 31Medium LN 88 1,63 1,63 10 <=0 0 27 1,95 0 7 0,40 0 247 18,76 18,76
2 5 32Medium LN 118 2,38 2,38 9 <=0 0 27 1,95 0 6 0,27 0 227 17,57 17,57
2 6 35Medium LN 3862,5 112,04 112,04 28 0,72 065,5 6,06 6,06 21 1,83 1,83 722 43,46 43,46
2 15 12S peptide LN 27 <=0 0 9 <=0 030,5 2,35 2,35 6 0,27 0 144 12,31 12,31
2 16 13S peptide LN 24 <=0 0 9 <=0 024,5 1,66 0 6 0,27 0 42,5 4,52 4,52
2 17 15S peptide LN 38 0,30 0 9 <=0 0 23 1,48 0 6 0,27 0 39 4,19 4,19
2 21 21S peptide LN 6019 228,22 228,22 43 1,39 01158 98,84 98,84 13 1,06 1,06 3419 169,20 169,20
2 22 22S peptide LN 9299 625,33 625,33 71 2,57 2,57 1738 147,12 147,12 17 1,45 1,45 3274 161,90 161,90
2 23 23S peptide LN 12071 1686,02 1686,02 80 2,94 2,94 1253 106,68 106,68 25,5 2,23 2,23 2581 128,41 128,41
2 24 24S peptide LN 6145 237,22 237,22 45 1,47 01326 112,68 112,68 13 1,06 1,06 3027 149,72 149,72
2 25 25S peptide LN 5060 168,77 168,77 50 1,69 1,69 2139 181,51 181,51 12 0,96 0 3253 160,86 160,86
2 26 26S peptide LN 3496 97,61 97,61 28,5 0,74 0 672 58,84 58,84 10 0,74 0 2548 126,87 126,87
2 27 27S peptide LN 4729 151,42 151,42 42 1,34 03101 268,62 268,62 14 1,16 1,16 2190 110,32 110,32
2 28 28S peptide LN 7910 405,40 405,40 54 1,86 1,86 1622 137,39 137,39 19 1,64 1,64 2899,5 143,55 143,55
2 18 31S peptide LN 1803,5 43,49 43,49 13 <=0 0 41 3,51 3,51 7 0,40 0701,5 42,47 42,47
2 19 32S peptide LN 3364,5 92,70 92,70 20 0,34 0 87 8,20 8,20 8 0,52 0553,5 35,21 35,21
2 20 35S peptide LN 4311 131,42 131,42 27 0,67 0 138 13,06 13,06 33 2,87 2,87 1182,5 64,83 64,83
2 29 11PMA Iono LN 12326 1874,34 1874,34 196 7,52 7,52 5467 527,14 527,14 37 3,20 3,20 16127 8492,61 5250
2 30 21PMA Iono LN 12488 2008,41 2008,41 333 12,79 12,79 8110 953,50 953,50 65 5,36 5,36 18009 5,2E+05 5250
2 31 22PMA Iono LN 13892 3937,75 3937,75 232 8,91 8,91 7472 830,47 830,47 57,5 4,80 4,80 17831 1,5E+05 5250
2 32 31PMA Iono LN 13092,5 2635,94 2635,94 287 11,02 11,02 7797 891,10 891,10 65 5,36 5,36 18563 1,7E+07 5250IFN-gamma IL-12p70 IL-13 IL-1beta IL-2
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709115
  
 
R&D Report R -20-0112  Version 01  Page 87 of 105 
  Strictly Confidential  
Table 32: Cytokine raw data and calculated data for mCorVAC#16 , part 6 of 6 (LN) 
Acquired MFI values (MFI) were converted into concentrations by ProcartaPlex Analysis software (c calc). Final concentrations (c fin) meet the following criteria: Values below the 
lower limit of quantification (<LLOQ, blue)) are set to zero. Values above the upper limit of quantification (> ULOQ, red) are  set to the ULOQ.  Commas are used as decimal 
separators. Thousand were not separated by  commas.  LN, lymph node. Gr, group. M, mouse ID. PMAIono, PMA and Ionomycin (positive control).  
Sample 
IDGrMRestimulat
ionTissue MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mL]cfin 
[pg/mL] MFIccalc 
[pg/mLcfin 
[pg/mL MFIccalc 
[pg/mL]cfin 
[pg/mL]
1 12Medium LN 5 <=0 0 94 13,14 13,14 17 7,72 7,72 37,5 4,19 4,19 6 1,14 0 14 <=0 0
2 13Medium LN 6 0,23 0 67 9,43 9,43 15 6,36 6,36 32 3,57 3,57 5 <=0 0,00 13 <=0 0
3 15Medium LN 8 0,37 0107,5 14,94 14,94 11 3,47 0 27 2,99 2,99 5 <=0 0,00 12 <=0 0
7 21Medium LN 17 0,95 0 44 6,09 6,09 15 6,36 6,36 28 3,11 3,11 7 1,50 0 18 <=0 0
8 22Medium LN 21 1,19 0 16 1,55 0 14 5,66 5,66 55 6,01 6,01 7 1,50 0 21 51,55 0
9 23Medium LN 11,5 0,61 0 12 0,77 0 17 7,72 7,72 32 3,57 3,57 6 1,14 022,5 70,19 0
10 24Medium LN 28 1,60 1,60 14 1,17 0 17 7,72 7,72 38 4,24 4,24 8 1,83 0 41 224,61 224,61
11 25Medium LN 33,5 1,90 1,90 39 5,33 5,33 17 7,72 7,72 47 5,20 5,20 7 1,50 0 19 19,32 0
12 26Medium LN 18,5 1,04 0 29 3,76 3,76 13 4,95 4,95 35,5 3,96 3,96 9 2,12 0 17 <=0 0,00
13 27Medium LN 23 1,31 1,31 126 17,36 17,36 16 7,04 7,04 48 5,30 5,30 16 3,78 3,78 42 231,36 231,36
14 28Medium LN 28 1,60 1,60 23 2,77 2,77 21 10,35 10,35 39 4,35 4,35 8 1,83 0 32 158,79 0
4 31Medium LN 6 0,23 0 33 4,40 4,40 11 3,47 0 25 2,74 0 5 <=0 0,00 18 <=0 0,00
5 32Medium LN 5 <=0 0,00 44 6,09 6,09 12 4,22 0 27 2,99 2,99 7 1,50 0 18 <=0 51750
6 35Medium LN 80 4,32 4,32 19 2,09 2,09 183 94,27 94,27 112 11,24 11,24 11 2,65 2,65 327 1366,33 1366,33
15 12S peptide LN 6 0,23 0 77 10,83 10,83 12 4,22 0 29 3,22 3,22 6 1,14 0 11 <=0 0,00
16 13S peptide LN 6,5 0,27 0 37 5,02 5,02 12 4,22 0 23 2,50 0 6 1,14 0 13 <=0 0,00
17 15S peptide LN 7 0,30 0 79 11,10 11,10 11 3,47 0 22,5 2,43 0 5 <=0 0,00 12 <=0 0,00
21 21S peptide LN 585 26,67 26,67 306 39,25 39,25 50,5 27,77 27,77 185 17,18 17,18 208,5 24,46 24,46 525 1945,60 1945,60
22 22S peptide LN 620 28,14 28,14 108 15,01 15,01 68,5 37,55 37,55 249 22,03 22,03 246,5 27,42 27,42 932 3012,15 3012,15
23 23S peptide LN 315 15,07 15,07 123,5 17,03 17,03 100 53,89 53,89 327,5 27,72 27,72 362 35,69 35,69 1379 4111,96 4111,96
24 24S peptide LN 722 32,50 32,50 124 17,10 17,10 51 28,04 28,04 190,5 17,61 17,61 326 33,21 33,21 566 2060,06 2060,06
25 25S peptide LN 676 30,52 30,52 838,5 98,03 98,03 41 22,40 22,40 242 21,51 21,51 333 33,69 33,69 466 1780,70 1780,70
26 26S peptide LN 374 17,63 17,63 172 23,18 23,18 35 18,92 18,92 114 11,41 11,41 176 21,79 21,79 304 1292,04 1292,04
27 27S peptide LN 388 18,23 18,23 3354,5 371,05 371,05 44 24,12 24,12 185,5 17,22 17,22 543 47,36 47,36 421 1650,50 1650,50
28 28S peptide LN 835 37,33 37,33 112 15,53 15,53 72 39,41 39,41 231,5 20,73 20,73 537 46,99 46,99 748 2542,37 2542,37
18 31S peptide LN 18 1,01 0 41 5,64 5,64 20 9,70 9,70 66 7,09 7,09 10 2,39 0145 731,35 731,35
19 32S peptide LN 22 1,25 1,25 137 18,77 18,77 17 7,72 7,72 76 8,03 8,03 17 3,99 3,99 256 1136,68 1136,68
20 35S peptide LN 83 4,47 4,47 23 2,77 2,77 185 95,21 95,21 188 17,41 17,41 40 7,78 7,78 375 1513,77 1513,77
29 11PMA Iono LN 802 35,92 35,92 6819 837,42 837,42 951 425,96 425,96 5191,5 528,45 528,45 1086 78,50 78,50 1598 4645,82 4645,82
30 21PMA Iono LN 930 41,41 41,41 11126 1777,66 1777,66 1430 628,21 628,21 6317 924,47 731,2 4143,5 273,05 273,05 2253 6278,43 6278,43
31 22PMA Iono LN 494 22,76 22,76 7001 866,85 866,85 1107 491,32 491,32 6276 901,77 731,2 3748 241,36 241,36 2246 6260,47 6260,47
32 31PMA Iono LN 1641 73,08 73,08 6896,5 849,87 849,87 2801 1244,18 1244,18 6159,5 842,57 731,2 3033,5 190,98 190,98 2431 6740,05 6740,05IL-5 IL-6 TNF-alpha GM-CSF IL-18 IL-4
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709116
  
 
R&D Report R -20-0112  Version 01  Page 88 of 105 
  Strictly Confidential  
9.6 Certificates of Analysis BNT162a1  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
(b) (6)
(b) (4)
FDA-CBER-2021-5683-0709117
  
 
R&D Report R -20-0112  Version 01  Page 89 of 105 
  Strictly Confidential  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
(b) (6)
(b) (6)
(b) (4)
FDA-CBER-2021-5683-0709118
  
 
R&D Report R -20-0112  Version 01  Page 90 of 105 
  Strictly Confidential  
9.7 Certificates of Analysis BNT162b1  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709119
  
 
R&D Report R -20-0112  Version 01  Page 91 of 105 
  Strictly Confidential  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
(b) (6)
(b) (4)
FDA-CBER-2021-5683-0709120
  
 
R&D Report R -20-0112  Version 01  Page 92 of 105 
  Strictly Confidential  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
(b) (4)
FDA-CBER-2021-5683-0709121
  
 
R&D Report R -20-0112  Version 01  Page 93 of 105 
  Strictly Confidential  
9.8 Certificates of Analysis BNT162b2  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709122
  
 
R&D Report R -20-0112  Version 01  Page 94 of 105 
  Strictly Confidential  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
(b) (4)
FDA-CBER-2021-5683-0709123
  
 
R&D Report R -20-0112  Version 01  Page 95 of 105 
  Strictly Confidential  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
(b) (6)
(b) (4)
FDA-CBER-2021-5683-0709124
  
 
R&D Report R -20-0112  Version 01  Page 96 of 105 
  Strictly Confidential  
9.9 Certificates of Analysis BNT162c2  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
(b) (4)
FDA-CBER-2021-5683-0709125
  
 
R&D Report R -20-0112  Version 01  Page 97 of 105 
  Strictly Confidential  
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
(b) (6)
(b) (4)
FDA-CBER-2021-5683-0709126
  
 
R&D Report R -20-0112  Version 01  Page 98 of 105 
  Strictly Confidential  
9.10 Statistical analysis  
ELISpot – details on statistical analysis performed with GraphPad Prism 8.  
Related to Figure  6 
Group Sidak's multiple 
comparisons test  Mean Diff,  95,00% CI of 
diff, Significant?  Summary  Adjusted P 
Value 
 
Control 
(mCorVac#15)  No peptide vs. S 
pepide  -4.938 -8.321 to -
1,554  Yes ** 0.0041  
Control RNA vs. S 
RNA  2.125 -1.258 to 5 .508 No ns 0.2696  
BNT162a1  
 No peptide vs. S 
pepide  -82.81  -103.4 to -
62.26  Yes **** <0.0001  
Control RNA vs. S 
RNA  -47.13 -67.67 to -
26.58  Yes **** <0.0001  
 
BNT162b1  
 No peptide vs. S 
pepide  -748.2  -894.1 to -
602.3  Yes **** <0.0001  
Control RNA vs. S 
RNA  -734.5  -880.4 to -
588.6  Yes **** <0.0001  
Control 
(mCorVac#16 ) No peptide vs. S 
peptide  -14.50  -22.73 to -
6.270  Yes *** 0.0007  
Control RNA vs. S 
RNA  2.438  -5.793 to 10.67  No ns 0.7333  
BNT162b2  No peptide vs. S 
peptide  -1177  -1314 to -1041  Yes **** <0.0001  
Control RNA vs. S 
RNA  -1311  -1448 to -1175  Yes **** <0.0001  
BNT162c2  
 No peptide vs. S 
peptide  -1174  -1293 to -1056  Yes **** <0.0001  
Control RNA vs. S 
RNA  -1171  -1290 to -1053  Yes **** <0.0001  
Flow cytometry  – details on statistical analysis performed with GraphPa d Prism 
8.  
Related to Figure  7 
Group Dunnett's 
multiple 
comparisons test  Mean 
Diff. 95.00% CI 
of diff. Significant?  Summary  Adjusted 
P Value  
CD8+ T cells  Control vs. 
BNT162a1  -1.250  -3.386 to 
0.8864  No ns 0.3001  
Control vs. 
BNT162b1  -1.225  -3.361 to 
0.9114  No ns 0.3130  
Control vs. 
BNT162b2  -10.63  -13.87 to  -
7.377  Yes **** <0.0001  
Control vs. 
BNT162c2  -0.4321  -3.794 to 
2.930  No ns 0.9348  
CD4+ T cells  Control vs. 
BNT162a1  1.188  -0.9863 to 
3.361  No ns 0.3445  
Control vs. 
BNT162b1  1.425  -0.7488 to 
3.599  No ns 0.2302  
Control vs. 
BNT162b2  11.06  7.473 to 
14.65 Yes **** <0.0001  
Control vs. 
BNT162c2  -0.7571  -4.473 to 
2.959  No ns 0.8463  
  
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709127
  
 
R&D Report R -20-0112  Version 01  Page 99 of 105 
  Strictly Confidential  
TFH cells Control vs. 
BNT162a1  -0.04500  -0.1701 to 
0.08005  No ns 0.6086  
Control vs. 
BNT162b1  -0.3726  -0.4977 to -
0.2476  Yes **** <0.0001  
Control vs. 
BNT162b2  -0.3828  -0.7397 to -
0.02579  Yes * 0.0350  
Control vs. 
BNT162c2  -1.190  -1.560 to -
0.8208  Yes **** <0.0001  
B cells  Control vs. 
BNT162a1  7.813  5.540 to 
10.08  Yes **** <0.0001  
Control vs. 
BNT162b1  7.900  5.628 to 
10.17  Yes **** <0.0001  
Control vs. 
BNT162b2  14.64  9.503 to 
19.77  Yes **** <0.0001  
Control vs. 
BNT162c2  9.921  4.607 to 
15.24  Yes *** 0.0005  
Related to Figure  8 
Group Dunnett's 
multiple 
comparisons 
test Mean 
Diff. 95.00% CI of 
diff. Significant?  Summary  Adjusted 
P Value 
CD44+CD38+PD1+ 
CD8+ T cells  
 Control vs. 
BNT162a1  -0.2575  -1.951 to 
1.436  No ns 0.9102  
Control vs. 
BNT162b1  -6.015  -7.708 to -
4.322  Yes **** <0.0001  
Control vs. 
BNT162b2  -28.05  -33.72 to -
22.37  Yes **** <0.0001  
Control vs. 
BNT162c2  -1.344  -7.222 to 
4.533  No ns 0.8115  
ICOS+ CD8+ T 
cells 
 Control vs. 
BNT162a1  -0.8663  -3.073 to 
1.341  No ns 0.5578  
Control vs. 
BNT162b1  -8.401  -10.61 to -
6.194  Yes **** <0.0001  
Control vs. 
BNT162b2  -40.48  -47.07 to -
33.89  Yes **** <0.0001  
Control vs. 
BNT162c2  -4.713  -11.54 to 
2.109  No ns 0.1998  
ICOS+ CD4+ T 
cells 
 Control vs. 
BNT162a1  -0.5650  -1.427 to 
0.2973  No ns 0.2304  
Control vs. 
BNT162b1  -2.551  -3.414 to -
1.689  Yes **** <0.0001  
Control vs. 
BNT162b2  -2.981  -5.174 to -
0.7890  Yes ** 0.0078  
Control vs. 
BNT162c2  1.218  -1.051 to 
3.488  No ns 0.3555  
ICOS+ Tfh cells  
 Control vs. 
BNT162a1  -10.11  -18.24 to -
1.987  Yes * 0.0143  
Control vs. 
BNT162b1  -26.43  -34.55 to -
18.30  Yes **** <0.0001  
Control vs. 
BNT162b2  -12.49  -21.24 to -
3.733  Yes ** 0.0054  
Control vs.  
BNT162c2  -19.20  -27.95 to -
10.45  Yes **** <0.0001  
 
090177e194f89529\Approved\Approved On: 22-Sep-2020 13:52 (GMT)
FDA-CBER-2021-5683-0709128
  
 
R&D Report R -20-0112  Version 01  Page 100 of 105 
  Strictly Confidential  
Related to Figure  9 
Group Dunnett's 
multiple 
comparisons 
test Mean 
Diff. 95.00% CI of 
diff. Significant?  Summary  Adjusted 
P Value  
CD8+ T cells  
 Control vs. 
BNT162a1  -337552  -833529 to 
158426  No ns 0.2084  
Control vs. 
BNT162b1  -420848  -916825 to 
75130  No ns 0.1019  
Control vs. 
BNT162b2  -683950  -1112484 to -
255415  Yes ** 0.0021  
Control vs. 
BNT162c2  -75551  -504086 to 
352984  No ns 0.8818  
CD4+ T cells 
 Control vs. 
BNT162a1  -749301  -1913693 to 
415091  No ns 0.2411  
Control vs. 
BNT162b1  -1246977  -2411369 to -
82585  Yes * 0.0352  
Control vs. 
BNT162b2  -1850559  -2886016 to -
815102  Yes *** 0.0007  
Control vs. 
BNT162c2  -216563  -1252020 to 
818895  No ns 0.8389  
TFH cells Control vs. 
BNT162a1  -2366  -7903 to 
3171  No ns 0.5051  
Control vs. 
BNT162b1  -14242  -19780 to -
8705  Yes **** <0.0001  
Control vs. 
BNT162b2  -46173  -60706 to -
31640  Yes **** <0.0001  
Control vs. 
BNT162c2  -4251  -18783 to 
10282  No ns 0.7150  
TH1 cells  
 Control vs. 
BNT162a1  -7820  -18193 to 
2552  No ns 0.1541  
Control vs. 
BNT162b1  -13043  -23416 to -
2671  Yes * 0.0134  
Control vs. 
BNT162b2  -2268  -4564 to 
28.31  No ns 0.0531  
Control vs. 
BNT162c2  297.1  -1999 to 
2593  No ns 0.9339  
Related to Figure  10 
Group Dunnett's 
multiple 
comparisons 
test Mean 
Diff. 95.00% CI of 
diff. Significant?  Summary  Adjusted 
P Value  
B cells  
 Control vs. 
BNT162a1  -415609  -1302980 to 
471763  No ns 0.4459  
Control vs. 
BNT162b1  -12666 93 -2154065 to -
379321  Yes ** 0.0053  
Control vs. 
BNT162b2  -761299  -1089182 to -
433417  Yes **** <0.0001  
Control vs. 
BNT162c2  26360  -301523 to 
354242  No ns 0.9738  
Plasma cells  
 Control vs. 
BNT162a1  -244.3  -18256 to 
17768  No ns 0.9992  
Control vs. 
BNT16 2b1 -20130  -38142 to -
2117  Yes * 0.0278  
090177e194f89529\Approved\Approved On: 22-Se
…[truncated]